pith. sign in

arxiv: 1411.6490 · v1 · pith:WJZQWTW3new · submitted 2014-11-24 · 🌌 astro-ph.SR

B fields in OB stars (BOB): on the detection of weak magnetic fields in the two early B-type stars beta CMa and epsilon CMa

classification 🌌 astro-ph.SR
keywords starsmagneticfieldfieldsweakdipolarmassivebeta
0
0 comments X
read the original abstract

Within the context of the "B fields in OB stars (BOB)" collaboration, we used the HARPSpol spectropolarimeter to observe the early B-type stars beta CMa (HD44743; B1 II/III) and epsilon CMa (HD52089; B1.5 II). For both stars, we consistently detected the signature of a weak (<30 G in absolute value) longitudinal magnetic field. We determined the physical parameters of both stars and characterise their X-ray spectrum. For beta CMa, our mode identification analysis led to determining a rotation period of 13.6+/-1.2 days and of an inclination angle of the rotation axis of 57.6+/-1.7 degrees, with respect to the line of sight. On the basis of these measurements and assuming a dipolar field geometry, we derived a best fitting obliquity of ~22 degrees and a dipolar magnetic field strength (Bd) of ~100 G (60<Bd<230 G within 1 sigma), below what is typically found for other magnetic massive stars. For epsilon CMa we could only determine a lower limit on the dipolar magnetic field strength of 13 G. For this star, we determine that the rotation period ranges between 1.3 and 24 days. Both stars are expected to have a dynamical magnetosphere. We also conclude that both stars are most likely core hydrogen burning and that they have spent more than 2/3 of their main sequence lifetime. A histogram of the distribution of the dipolar magnetic field strength for the magnetic massive stars known to date does not show the magnetic field "desert" observed instead for intermediate-mass stars. The biases involved in the detection of (weak) magnetic fields in massive stars with the currently available instrumentation and techniques imply that weak fields might be more common than currently observed. Our results show that, if present, even relatively weak magnetic fields are detectable in massive stars and that more observational effort is probably still needed to properly access the magnetic field incidence.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Stripped-Envelope Supernovae for QCD Axion Detection

    hep-ph 2025-11 unverdicted novelty 6.0

    Stripped-envelope supernovae enable QCD axion detection to masses around 10^{-4} eV via gamma-ray signals from conversion in progenitor magnetic fields.