pith. sign in

arxiv: 2605.05827 · v1 · submitted 2026-05-07 · 🪐 quant-ph · cond-mat.stat-mech· physics.optics

Pontus-Mpemba effect in cavity quantum electrodynamics

Stefano Longhi This is my paper

Pith reviewed 2026-05-08 11:37 UTC · model grok-4.3

classification 🪐 quant-ph cond-mat.stat-mechphysics.optics
keywords quantum Pontus-Mpemba effectcavity QEDJaynes-Cummings modelphoton lossdissipative quenchatomic excitation decayRabi oscillationsopen quantum systems
0
0 comments X

The pith

A sudden quench of cavity loss rate makes atomic excitation decay faster than constant loss in the Jaynes-Cummings model.

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

This paper proposes a concrete way to observe the quantum Pontus-Mpemba effect by coupling a two-level atom to a single lossy cavity mode. A sudden drop in the cavity decay rate alters the evolution so that the atom reaches its ground state quicker than it would under unchanging loss. The acceleration arises because the quench shifts the trajectory of the damped oscillations between atom and photon. The setup stays within the single-excitation sector and uses only standard Jaynes-Cummings dynamics, making it feasible in current optical or circuit QED experiments.

Core claim

In the single-excitation sector of the Jaynes-Cummings model with photon loss, a sudden quench of the cavity decay rate produces non-monotonic accelerated decay of the atomic excitation probability, reaching the ground state faster than the monotonic decay under fixed loss. The effect follows from the coherent atom-photon exchange competing with cavity dissipation, and it holds across weak to strong dissipation regimes where the dynamics transition from damped Rabi oscillations to near-exponential decay.

What carries the argument

The sudden quench of the cavity decay rate, which switches the system between two distinct damped-evolution trajectories starting from the same initial atom-cavity state.

Load-bearing premise

The system remains in the single-excitation sector and the Jaynes-Cummings model with instantaneous change in photon loss rate continues to describe the dynamics accurately.

What would settle it

Time-resolved measurement of the atomic excitation probability after the quench; the central claim is false if the quenched curve does not reach near-zero excitation sooner than the fixed-loss curve.

Figures

Figures reproduced from arXiv: 2605.05827 by Stefano Longhi.

Figure 1
Figure 1. Figure 1: (a) Schematic of the dissipative Jaynes-Cummings model. A two-level atom is placed inside a high-𝑄 optical cavity with photon loss rate 𝜅. The atom-photon coupling rate is 𝑔. At the initial time, the atom is in the excited state while the cavity field is in the vacuum state (state I). The dissipative dynamics drives the system toward the equilibrium state E, corresponding to the atom in the ground state an… view at source ↗
Figure 2
Figure 2. Figure 2: Behavior of (a) the real, and (b) the imaginary parts of the four eigenvalues 𝜆 of the dynamical matrix 𝐑 versus the normalized photon loss rate 𝜅∕𝑔 for Δ = 𝛾 = 0. At the critical dissipation (𝑔∕𝜅) 𝑐 = 4 two eigenvalues of 𝐑, together with their corresponding eigenvectors, coalesce, corresponding to an exceptional point. The exceptional point separates the weak and strong dissipative regimes. so that the e… view at source ↗
Figure 3
Figure 3. Figure 3: Typical dynamical evolution in the dissipative Jaynes–Cummings system illustrating the quantum Pontus– Mpemba effect. Dashed blue lines correspond to the two-step protocol, where the cavity decay rate is initially low (𝜅1 ≪ 𝑔) and switched to high loss (𝜅 ≫ 𝑔) at time 𝜏 = 𝜋∕(2𝑔). Solid red lines correspond to the single-step high-loss evolution. (a) Excited atomic population 𝑃𝑒 (𝑡) = 𝜌1,1 (𝑡). (b) Cavity p… view at source ↗
Figure 4
Figure 4. Figure 4: Same as Fig.3, but for parameter values 𝜅∕𝑔 = 8, 𝜅1∕𝑔 = 0.1, Δ∕𝑔 = −0.2, and 𝛾∕𝑔 = 0.1 view at source ↗
Figure 5
Figure 5. Figure 5: Phase diagrams showing the regions of parameter space in which the Pontus–Mpemba effect is observable. The dark shaded areas indicate where the effect occurs, while the white regions correspond to its absence. (a) Domain in the (𝜏∕𝜏0 , Δ∕𝑔) plane for 𝜅∕𝑔 = 8, 𝜅1∕𝑔 = 0, and 𝛾 = 0. (b) Domain in the (𝜏∕𝜏0 , 𝛾∕𝑔) plane for 𝜅∕𝑔 = 8, 𝜅1∕𝑔 = 0, and Δ = 0. (c) Domain in the (𝛾∕𝑔, Δ∕𝑔) plane for 𝜅∕𝑔 = 8, 𝜅1∕𝑔 = 0,… view at source ↗
Figure 6
Figure 6. Figure 6: Same as Fig.3, but for the initial state I given by |𝑒, 1⟩⟨𝑒, 1|. The swtiching time is 𝜏 = 𝜋∕(2√2𝑔) view at source ↗
Figure 7
Figure 7. Figure 7: Relaxation dynamics in the dissipative Jaynes–Cummings system with finite temperature baths illustrating the persistence of the quantum Pontus–Mpemba effect. Dashed blue lines correspond to the two-step protocol, where the cavity decay rate is initially low (𝜅1 ≪ 𝑔) and switched to high loss (𝜅 ≫ 𝑔) at time 𝜏 = 𝜏0 = 𝜋∕(2𝑔). Solid red lines correspond to the single-step high-loss evolution. (a) Excited atom… view at source ↗
read the original abstract

The quantum Pontus-Mpemba effect is a counterintuitive phenomenon in which a quantum system relaxes faster through a two-step evolution protocol than through a single, unquenched relaxation. This work proposes its realization in cavity quantum electrodynamics using the Jaynes-Cummings model with photon loss. The model captures the coherent interaction between a two-level atom and a single quantized mode of a lossy cavity, providing a minimal yet realistic setting to explore dissipative quantum dynamics. Restricting the analysis to the single-excitation sector, the dynamics feature damped vacuum Rabi oscillations for weak dissipation that transition to near-exponential atomic decay under strong dissipation. A sudden quench of the cavity decay rate generates distinct relaxation trajectories from the same initial atom-cavity state. The atomic excitation then displays a non-monotonic, accelerated decay, where a trajectory with a quenched dissipation relaxes faster than fixed-loss evolution. The effect originates from the interplay between coherent atom-photon exchange and cavity dissipation, establishing a clear and experimentally accessible realization of the quantum Pontus-Mpemba effect in both optical and circuit QED platforms.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit. Tearing a paper down is the easy half of reading it; the pith above is the substance, this is the friction.

Referee Report

1 major / 3 minor

Summary. The manuscript proposes realizing the quantum Pontus-Mpemba effect in cavity QED via the lossy Jaynes-Cummings model restricted to the single-excitation sector. A sudden quench of the cavity decay rate produces a non-monotonic atomic excitation trajectory that reaches low values faster than the constant-rate evolution, arising from competition between coherent atom-photon exchange and tunable dissipation. The setting is minimal, uses the standard master equation, and is claimed to be experimentally accessible in optical or circuit QED.

Significance. If the reported dynamics hold, the work supplies a clean, parameter-free platform for anomalous relaxation in an open quantum system that is directly realizable with existing technology. The restriction to the standard JC Hamiltonian without invented terms or fitted parameters is a strength, as is the explicit link to tunable cavity loss.

major comments (1)
  1. [Section III] Section III (or equivalent dynamics section): the claim of accelerated relaxation requires a quantitative metric (e.g., time to reach 1/e of initial excitation or integrated area under the excitation curve) comparing the quenched and fixed-κ trajectories. Without this metric and the associated numerical or analytic evidence, the central 'faster' assertion remains qualitative.
minor comments (3)
  1. [Model section] The sudden-quench modeling of κ(t) as an ideal step function should be accompanied by a brief discussion of its physical realizability (e.g., finite switching time) to confirm it does not introduce extraneous decoherence.
  2. [Figures] Figure captions must list all parameter values (g, κ_initial, κ_final, initial state) used for each panel so that the plots are reproducible from the text alone.
  3. [Introduction] The abstract and introduction should cite the original Pontus-Mpemba literature and recent quantum realizations to clarify the precise novelty of the cavity-QED implementation.

Simulated Author's Rebuttal

1 responses · 0 unresolved

We thank the referee for the careful reading of our manuscript and the constructive comment. We appreciate the positive assessment of the work's significance and experimental accessibility. We address the major comment below and have revised the manuscript accordingly.

read point-by-point responses

  1. Referee: [Section III] Section III (or equivalent dynamics section): the claim of accelerated relaxation requires a quantitative metric (e.g., time to reach 1/e of initial excitation or integrated area under the excitation curve) comparing the quenched and fixed-κ trajectories. Without this metric and the associated numerical or analytic evidence, the central 'faster' assertion remains qualitative.

    Authors: We agree that the claim of accelerated relaxation benefits from an explicit quantitative metric. In the revised manuscript we have added to Section III a direct comparison of the quenched and constant-κ trajectories using two standard measures: the time t_{1/e} at which the atomic excitation probability first drops to 1/e of its initial value, and the integrated area under the excitation curve. These quantities are evaluated from the numerical solution of the master equation in the single-excitation subspace and are now reported together with the existing dynamical plots. The added analysis converts the previously qualitative statement into a quantitatively supported assertion while leaving all other results unchanged. revision: yes

Circularity Check

0 steps flagged

No significant circularity; derivation follows directly from standard master equation

full rationale

The paper's central result—the non-monotonic accelerated atomic decay under a sudden quench of cavity loss—is obtained by direct integration of the time-dependent Lindblad master equation for the Jaynes-Cummings Hamiltonian restricted to the single-excitation manifold. No parameters are fitted to data and then relabeled as predictions; the quench is introduced explicitly as a step change in the decay rate; and no load-bearing uniqueness theorem or ansatz is imported via self-citation. The reported trajectories are therefore genuine dynamical consequences of the model rather than tautological restatements of its inputs.

Axiom & Free-Parameter Ledger

0 free parameters · 2 axioms · 0 invented entities

The claim rests on the standard Jaynes-Cummings Hamiltonian plus Lindblad loss term, the single-excitation truncation, and the assumption that a sudden change in the decay rate is physically realizable without additional transients.

axioms (2)
  • domain assumption The system remains in the single-excitation manifold throughout the evolution.
    Explicitly stated in the abstract as the regime of analysis.
  • ad hoc to paper The cavity decay rate can be quenched instantaneously without introducing extra decoherence channels.
    Required for the two-step protocol but not derived from first principles.

pith-pipeline@v0.9.0 · 5483 in / 1315 out tokens · 28278 ms · 2026-05-08T11:37:21.564056+00:00 · methodology

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Quantum Mpemba effect for operators in open systems

    cond-mat.stat-mech 2026-05 unverdicted novelty 7.0

    Operators evolving under the adjoint Liouvillian in open quantum systems can exhibit a genuine Mpemba effect, with general conditions derived and validated across three setups.

Reference graph

Works this paper leans on

90 extracted references · 90 canonical work pages · cited by 1 Pith paper · 2 internal anchors

  1. [1]

    E. B. Mpemba, D. G. Osborne, Cool?, Phys. Educ. 4 (1969) 172

    work page 1969

  2. [2]

    G. S. Kell, The freezing of hot and cold water, Am. J. Phys. 37 (1969) 564

    work page 1969

  3. [3]

    Jeng, The Mpemba effect: when can hot water freeze faster than cold?, Am

    M. Jeng, The Mpemba effect: when can hot water freeze faster than cold?, Am. J. Phys. 74 (2006) 514

    work page 2006

  4. [4]

    J.Bechhoefer,A.Kumar,R.Chetrite,AfreshunderstandingoftheMpembaeffect,Nat.Rev.Phys.3(2021)534

    work page 2021

  5. [5]

    A.Lasanta,F.VegaReyes,A.Prados,A.Santos,Whenthehottercoolsmorequickly:Mpembaeffectingranular fluids, Phys. Rev. Lett. 119 (2017) 148001

    work page 2017

  6. [6]

    Z. Lu, O. Raz, Nonequilibrium thermodynamics of the Markovian Mpemba effect and its inverse, Proc. Natl. Acad. Sci. USA 114 (2017) 5083

    work page 2017

  7. [7]

    Klich, O

    I. Klich, O. Raz, O. Hirschberg, M. Vucelja, Mpemba index and anomalous relaxation, Phys. Rev. X 9 (2019) 021060

    work page 2019

  8. [8]

    Kumar, J

    A. Kumar, J. Bechhoefer, Exponentially faster cooling in a colloidal system, Nature 584 (2020) 64

    work page 2020

  9. [9]

    Baity-Jesi, E

    M. Baity-Jesi, E. Calore, A. Cruz, L. A. Fernandez, J. M. Gil-Narvion, A. Gordillo-Guerrero, D. Iniguez, A. Lasanta,A.Maiorano,E.Marinari,V.Martin-Mayor,J.Moreno-Gordo,A.Munoz-Sudupe,D.Navarro,G.Parisi, S. Perez-Gaviro, F. Ricci-Tersenghi, J. J. Ruiz-Lorenzo, S. F. Schifano, B. Seoane, A. Tarancon, R. Tripiccione, D. Yllanes, The Mpemba effect in spin gla...

    work page 2019

  10. [10]

    Biswas, V.V

    A. Biswas, V.V. Prasad, O. Raz, R. Rajesh, Mpemba effect in driven granular Maxwell gases, Phys. Rev. E 102 (2020) 012906

    work page 2020

  11. [11]

    A.Biswas,V.V.Prasad,andR.Rajesh,Mpembaeffectindrivengranulargases:Roleofdistancemeasures,Phys. Rev. E 108 (2023) 024902. S. Longhi:Preprint submitted to ElsevierPage 11 of 15 Pontus-Mpemba effect in cavity quantum electrodynamics

    work page 2023

  12. [12]

    G. Teza, R. Yaacoby, O. Raz, Relaxation shortcuts through boundary coupling, Phys. Rev. Lett. 131 (2023) 017101

    work page 2023

  13. [13]

    T. V. Vu, H. Hayakawa, Thermomajorization Mpemba effect, Phys. Rev. Lett. 134 (2025) 107101

    work page 2025

  14. [14]

    G.Teza,J.Bechhoefer,A.Lasanta,O.Raz,M.Vucelja,Speedupsinnonequilibriumthermalrelaxation:Mpemba and related effects, Phys. Rep. 1164 (2026) 1–97

    work page 2026

  15. [15]

    F. Ares, P. Calabrese, S. Murciano, The quantum Mpemba effects, Nat. Rev. Phys. 7 (2025) 451–460

    work page 2025

  16. [16]

    A. Nava, M. Fabrizio, Lindblad dissipative dynamics in the presence of phase coexistence, Phys. Rev. B 100 (2019) 125102

    work page 2019

  17. [17]

    Carollo, A

    F. Carollo, A. Lasanta, I. Lesanovsky, Exponentially accelerated approach to stationarity in Markovian open quantum systems through the Mpemba effect, Phys. Rev. Lett. 127 (2021) 060401

    work page 2021

  18. [18]

    S. K. Manikandan, Equidistant quenches in few-level quantum systems, Phys. Rev. Res. 3 (2021) 043108

    work page 2021

  19. [19]

    Kochsiek, F

    S. Kochsiek, F. Carollo, I. Lesanovsky, Accelerating the approach of dissipative quantum spin systems towards stationarity through global spin rotations, Phys. Rev. A 106 (2022) 012207

    work page 2022

  20. [20]

    Ivander, N

    F. Ivander, N. Anto-Sztrikacs, D. Segal, Hyperacceleration of quantum thermalization dynamics by bypassing long-lived coherences: An analytical treatment, Phys. Rev. E 108 (2023) 014130

    work page 2023

  21. [21]

    Zhou, X.-D

    Y.-L. Zhou, X.-D. Yu, C.-W. Wu, X.-Q. Li, J. Zhang, W. Li, P. X. Chen, Accelerating relaxation through Liouvillian exceptional point, Phys. Rev. Res. 5 (2023) 043036

    work page 2023

  22. [22]

    A.K.Chatterjee,S.Takada,H.Hayakawa,QuantumMpembaeffectinaquantumdotwithreservoirs,Phys.Rev. Lett. 131 (2023) 080402

    work page 2023

  23. [23]

    Moroder, O

    M. Moroder, O. Culhane, K. Zawadzki, J. Goold, Thermodynamics of the quantum Mpemba effect, Phys. Rev. Lett. 133 (2024) 140404

    work page 2024

  24. [24]

    A.K.Chatterjee,S.Takada,H.Hayakawa,MultiplequantumMpembaeffect:exceptionalpointsandoscillations, Phys. Rev. A 110 (2024) 022213

    work page 2024

  25. [25]

    Biswas, A

    A. Biswas, A. Pal, Mpemba effect on nonequilibrium active Markov chains, Phys. Rev. E 111 (2025) 054136

    work page 2025

  26. [26]

    A.Nava,R.Egger,Mpembaeffectsinopennonequilibriumquantumsystems,Phys.Rev.Lett.133(2024)136302

    work page 2024

  27. [27]

    S.A.Shapira,Y.Shapira,J.Markov,G.Teza,N.Akerman,O.Raz,R.Ozeri,InverseMpembaeffectdemonstrated on a single trapped ion qubit, Phys. Rev. Lett. 133 (2024) 010403

    work page 2024

  28. [28]

    X. Wang, J. Wang, Mpemba effects in nonequilibrium open quantum systems, Phys. Rev. Res. 6 (2024) 033330

    work page 2024

  29. [29]

    D.Liu,J.Yuan,H.Ruan,Y.Xu,S.Luo,J.He,X.He,Y.Ma,J.Wang,Speedingupquantumheatenginesbythe Mpemba effect, Phys. Rev. A 110 (2024) 042218

    work page 2024

  30. [30]

    Longhi, Bosonic Mpemba effect with non-classical states of light, APL Quantum 1 (2024) 046110

    S. Longhi, Bosonic Mpemba effect with non-classical states of light, APL Quantum 1 (2024) 046110

    work page 2024

  31. [31]

    Longhi, Laser Mpemba effect, Opt

    S. Longhi, Laser Mpemba effect, Opt. Lett. 50 (2025) 2069

    work page 2025

  32. [32]

    Longhi, Mpemba effect and super-accelerated thermalization in the damped quantum harmonic oscillator, Quantum 9 (2025) 1677

    S. Longhi, Mpemba effect and super-accelerated thermalization in the damped quantum harmonic oscillator, Quantum 9 (2025) 1677

    work page 2025

  33. [33]

    J.W.Dong,H.F.Mu,M.Qin,H.T.Cui,QuantumMpembaeffectoflocalizationinthedissipativemosaicmodel, Phys. Rev. A 111 (2025) 022215

    work page 2025

  34. [34]

    Zhang, G

    J. Zhang, G. Xia, C.-W. Wu, T. Chen, Q. Zhang, Y. Xie, W.-B. Su, W. Wu, C.-W. Qiu, P. Chen, W. Li, H. Jing, Y.-L. Zhou, Observation of quantum strong Mpemba effect, Nat. Commun. 16 (2025) 301. S. Longhi:Preprint submitted to ElsevierPage 12 of 15 Pontus-Mpemba effect in cavity quantum electrodynamics

    work page 2025

  35. [35]

    Furtado and A

    J. Furtado and A. C. Santos, Enhanced quantum Mpemba effect with squeezed thermal reservoirs,Ann. Phys. 480(2025) 170135

    work page 2025

  36. [36]

    D.Qian,H.Wang,J.Wang,IntrinsicquantumMpembaeffectinMarkoviansystemsandquantumcircuits,Phys. Rev. B 111 (2025) L220304

    work page 2025

  37. [37]

    S.Longhi,QuantumMpembaeffectfrominitialsystem-reservoirentanglement,APLQuantum2(2025)026133

    work page 2025

  38. [38]

    Boubakour, S

    M. Boubakour, S. Endo, T. Fogarty, T. Busch, Dynamical invariant based shortcut to equilibration in open quantum systems, Quantum Sci. Technol.10(2025) 015036

    work page 2025

  39. [39]

    D.J.Strachan,A.Purkayastha,S.R.Clark,Non-MarkovianquantumMpembaeffect,Phys.Rev.Lett.134(2025) 220403

    work page 2025

  40. [40]

    Longhi, Quantum Mpemba effect from non-normal dynamics, Entropy 27 (2025) 581

    S. Longhi, Quantum Mpemba effect from non-normal dynamics, Entropy 27 (2025) 581

    work page 2025

  41. [41]

    Medina, O

    I. Medina, O. Culhane, F.C. Binder, G.T. Landi, J. Goold, Anomalous discharging of quantum batteries: The ergotropic Mpemba effect, Phys. Rev. Lett. 134 (2025) 220402

    work page 2025

  42. [42]

    Y. Li, W. Li, X. Li, Ergotropic Mpemba effect in non-Markovian quantum systems, Phys. Rev. A 112 (2025) 032209

    work page 2025

  43. [43]

    Mondal, U

    S. Mondal, U. Sen, Mpemba effect in self-contained quantum refrigerators: accelerated cooling, Phys. Rev. A 113 (2026) 022211

    work page 2026

  44. [44]

    M. Xu, Z. Wei, X.-P. Jiang, L. Pan, Expedited thermalization dynamics in incommensurate systems, Phys. Rev. A 112 (2025) 042210

    work page 2025

  45. [45]

    Z. Wei, M. Xu, X.-P. Jiang, H. Hu, L. Pan, Quantum Mpemba effect in dissipative spin chains at criticality, Sci. China-Phys. Mech. Astron. 66 (4) (2026) 240315

    work page 2026

  46. [46]

    W. Ma, J. Liu, Quantum Mpemba effect in parity-time symmetric systems, Phys. Rev. B 112 (2025) 214310

    work page 2025

  47. [47]

    P.Bagui,A.Chatterjee,B.K.Agarwalla,DetectionofMpembaeffectthroughgoodobservablesinopenquantum systems, arXiv:2512.02709 [cond-mat.stat-mech]

    work page arXiv

  48. [48]

    F. Ares, S. Murciano, P. Calabrese, Entanglement asymmetry as a probe of symmetry breaking, Nat. Commun. 14 (2023) 2036

    work page 2023

  49. [49]

    L. Kh. Joshi, J. Franke, A. Rath, F. Ares, S. Murciano, F. Kranzl, R. Blatt, P. Zoller, B. Vermersch, P. Calabrese, C. F. Roos, M. K. Joshi, Observing the quantum Mpemba effect in quantum simulations, Phys. Rev. Lett. 133 (2024) 010402

    work page 2024

  50. [50]

    C.Rylands,K.Klobas,F.Ares,P.Calabrese,S.Murciano,B.Bertini,MicroscopicoriginofthequantumMpemba effect in integrable systems, Phys. Rev. Lett. 133 (2024) 010401

    work page 2024

  51. [51]

    Murciano, F

    S. Murciano, F. Ares, I. Klich, P. Calabrese, Entanglement asymmetry and quantum Mpemba effect in the XY spin chain, J. Stat. Mech. 013103 (2024)

    work page 2024

  52. [52]

    Caceffo, S

    F. Caceffo, S. Murciano, V. Alba, Entangled multiplets, asymmetry, and quantum Mpemba effect in dissipative systems, J. Stat. Mech. 063103 (2024)

    work page 2024

  53. [53]

    Liu, H.-K

    S. Liu, H.-K. Zhang, S. Yin, S.-X. Zhang, Symmetry restoration and quantum Mpemba effect in symmetric random circuits, Phys. Rev. Lett. 133 (2024) 140405

    work page 2024

  54. [54]

    Chalas, F

    K. Chalas, F. Ares, C. Rylands, P. Calabrese, Multiple crossing during dynamical symmetry restoration and implications for the quantum Mpemba effect, J. Stat. Mech. 103101 (2024)

    work page 2024

  55. [55]

    Yamashika, F

    S. Yamashika, F. Ares, P. Calabrese, Entanglement asymmetry and quantum Mpemba effect in two-dimensional free-fermion systems, Phys. Rev. B 110 (2024) 085126. S. Longhi:Preprint submitted to ElsevierPage 13 of 15 Pontus-Mpemba effect in cavity quantum electrodynamics

    work page 2024

  56. [56]

    S.Yamashika,P.Calabrese,F.Ares,Quenchingfromsuperfluidtofreebosonsintwodimensions:entanglement, symmetries, and quantum Mpemba effect, Phys. Rev. A 111 (2025) 043304

    work page 2025

  57. [57]

    S.Liu,H.-K.Zhang,S.Yin,S.-X.Zhang,H.Yao,QuantumMpembaeffectsinmany-bodylocalizationsystems, Sci. Bull. 70 (23) (2025) 3991-3996

    work page 2025

  58. [58]

    B 112 (2025) L121109

    T.Bhore,L.Su,I.Martin,A.A.Clerk,Z.Papic,QuantumMpembaeffectwithoutglobalsymmetries,Phys.Rev. B 112 (2025) L121109

    work page 2025

  59. [59]

    Yu, T.-R

    Y.-H. Yu, T.-R. Jin, L. Zhang, K. Xu, H. Fan, Tuning the quantum Mpemba effect in an isolated system by initial-state engineering, Phys. Rev. B 112 (2025) 094315

    work page 2025

  60. [60]

    Xuet al., Observation and Modulation of the Quantum Mpemba Effect on a Superconducting Quantum Processor, (2025), arXiv:2508.07707 [quant-ph]

    Y.Xu,C.-P.Fang,B.-J.Chen,M.-C.Wang,Z.-Y.Ge,Y.-H.Shi,Y.Liu,C.-L.Deng,K.Zhao,Z.-H.Liu,T.-M.Li, H.Li,Z.Wang,G.-H.Liang,D.Feng,X.Guo,X.-Y.Gu,Y.He,H.-T.Liu,Z.-Y.Mei,Y.Xiao,Y.Yan,Y.-H.Yu, W.-P. Yuan, J.-C. Zhang, Z.-A. Wang, G. Liu, X. Song, Y. Tian, Y.-R. Zhang, S.-X. Zhang, K. Huang, Z. Xiang, D. Zheng, K. Xu, H. Fan, Observation and modulation of the quantum...

    work page internal anchor Pith review arXiv 2025

  61. [61]

    S. Guo, S. Yin, S.-X. Zhang, Z.-X. Li, Skin effect induced anomalous dynamics from charge-fluctuating initial states, Phys. Rev. B 112 (2025) 155419

    work page 2025

  62. [62]

    Nava and R

    A. Nava and R. Egger, Pontus-Mpemba effects, Phys. Rev. Lett. 135 (2025) 140404

    work page 2025

  63. [63]

    H. Yu, J. Hu, and S.-X. Zhang, Quantum Pontus-Mpemba Effects in Real and Imaginary-time Dynamics, arXiv:2509.01960 [quant-ph] (2025),

    work page internal anchor Pith review Pith/arXiv arXiv 2025

  64. [64]

    A.Nava,R.Egger,B.Dey,andD.Giuliano,SpeedingupPontus-Mpembaeffectsviadynamicalphasetransitions, Phys. Rev. Research 7 (2025) 043332

    work page 2025

  65. [65]

    S.Aditya,A.Summer,P.Sierant,X.Turkeshi,Mpembaeffectsinquantumcomplexity,arXiv:2509.22176[quant- ph] (2025)

    work page arXiv 2025

  66. [66]

    Longhi, Quantum Pontus-Mpemba Effect Enabled by the Liouvillian Skin Effect, J

    S. Longhi, Quantum Pontus-Mpemba Effect Enabled by the Liouvillian Skin Effect, J. Phys. A: Math. Theor. 59 (2026) 065304

    work page 2026

  67. [67]

    Jaynes, F.W

    E.T. Jaynes, F.W. Cummings, Comparison of quantum and semiclassical radiation theories with application to the beam maser, Proc. IEEE 51 (1963) 89-109

    work page 1963

  68. [68]

    Shore, P.L

    B.W. Shore, P.L. Knight, The Jaynes-Cummings model, J. Mod. Opt. 40 (1993) 1195-1238

    work page 1993

  69. [69]

    Scully, M.S

    M.O. Scully, M.S. Zubairy,Quantum Optics, Cambridge University Press, Cambridge, 1997

    work page 1997

  70. [70]

    Haroche, J.-M

    S. Haroche, J.-M. Raimond,Exploring the Quantum: Atoms, Cavities, and Photons, Oxford University Press, Oxford, 2006

    work page 2006

  71. [71]

    Brune, F

    M. Brune, F. Schmidt-Kaler, A. Maali, J. Dreyer, E. Hagley, J. M. Raimond, S. Haroche, Quantum Rabi oscillation: A direct test of field quantization in a cavity, Phys. Rev. Lett. 76 (11) (1996) 1800-1803

    work page 1996

  72. [72]

    A 79 (3) (2009) 033836

    M.Wilczewski,M.Czachor,TheoryversusexperimentforvacuumRabioscillationsinlossycavities,Phys.Rev. A 79 (3) (2009) 033836

    work page 2009

  73. [73]

    R.R.Puri,G.S.Agarwal,Finite-Qcavityelectrodynamics:Dynamicalandstatisticalaspects,Phys.Rev.A35(8) (1987) 3433-3449

    work page 1987

  74. [74]

    3 (1991) 13–32

    P.Alsing,H.J.Carmichael,Spontaneousdressed-statepolarizationofacoupledatomandcavitymode,Quantum Opt. 3 (1991) 13–32

    work page 1991

  75. [75]

    J.Gea-Banacloche,Jaynes-Cummingsmodelwithquasiclassicalfields:theeffectofdissipation,Phys.Rev.A47 (3) (1993) 2221-2234. S. Longhi:Preprint submitted to ElsevierPage 14 of 15 Pontus-Mpemba effect in cavity quantum electrodynamics

    work page 1993

  76. [76]

    Briegel, B.-G

    H.-J. Briegel, B.-G. Englert, Quantum optical master equations: The use of damping bases, Phys. Rev. A 47 (1993) 3311-3329

    work page 1993

  77. [77]

    J.G.P.deFaria,M.C.Nemes,DissipativedynamicsoftheJaynes-Cummingsmodelinthedispersiveapproxima- tion: Analytical results, Phys. Rev. A 59 (5) (1999) 3918-3925

    work page 1999

  78. [78]

    Scala, B

    M. Scala, B. Militello, A. Messina, S. Maniscalco, J. Piilo, K.-A. Suominen, Cavity losses for the dissipative Jaynes-Cummings Hamiltonian beyond rotating wave approximation, J. Phys. A: Math. Theor. 40 (48) (2007) 14527-14536

    work page 2007

  79. [79]

    H. J. Carmichael, Breakdown of photon blockade: A dissipative quantum phase transition in zero dimensions, Phys. Rev. X 5 (2015) 031028

    work page 2015

  80. [80]

    Hwang, P

    M.-J. Hwang, P. Rabl, M. B. Plenio, Dissipative phase transition in the open quantum Rabi model, Phys. Rev. A 97 (1) (2018) 013825

    work page 2018

Showing first 80 references.