Pith. sign in

REVIEW 1 major objections 4 minor 22 references

Multilayer Cryogenic Powder Filters with Low Parasitic Capacitance

T0 review · 1 major / 4 minor · reviewed 2026-08-06 · deepseek-v4-flash

Pith's one-line read A layered cryogenic filter blocks gigahertz noise with roughly one-tenth the parasitic capacitance of a conventional powder filter, preserving the bandwidth of sensitive amplifiers.

desk verdict A genuinely new layered powder filter with 40x lower parasitic capacitance; the central claim holds, but the paper must clarify or verify the cryogenic capacitance to fully land it. read the letter →

arxiv 2507.23388 v1 pith:7Q5BYY7F submitted 2025-07-31 cond-mat.mes-hall

classification cond-mat.mes-hall
keywords powderfiltercryogenicparasiticcapacitanceRFattenuationskineffecttransimpedanceamplifierquantumtransportmeasurementEccosorbCR-124
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

Cryogenic quantum transport experiments need to stop microwave noise from reaching a sample through the wiring, but the standard metal-powder filter that does this also adds a large parasitic capacitance to ground, which slows down sensitive amplifiers. This paper claims that a multilayer 'layered filter'—where the central wire and the chassis are each coated with metal-powder epoxy and separated by an air gap—gets most of the attenuation while cutting the parasitic capacitance by roughly an order of magnitude. A 20 mm layered filter attenuates signals by 30 to 40 dB above 10 GHz with about 5 pF of parasitic capacitance, whereas a conventional 20 mm filter of the same packaging has about 50 pF. The point of the trade-off is practical: with the layered filter inserted, a homemade cryogenic transimpedance amplifier keeps its flat MHz-band response and noise floor, while the conventional filter cuts the bandwidth by about an order of magnitude. If the design holds up at low temperatures, it would let researchers filter their wiring without sacrificing measurement speed.

What carries the argument

The load-bearing element is the layered geometry itself: a central conductor coated with metal-powder epoxy inside a polymer tube, and a chassis whose inner surfaces are coated with the same epoxy, separated by an air gap rather than being fully potted in epoxy. The metal-powder epoxy is what produces high-frequency attenuation through the skin effect, while the low-dielectric-constant air gap is what keeps the parasitic capacitance low; the geometry also raises the characteristic impedance to about 65 Ω. The design works because the two functions—blocking microwaves and not loading the measurement line—are assigned to different spatial regions of the same compact package.

What would settle it

Measure the capacitance of a layered 20 mm filter at 4.2 K (for instance with a cryogenic capacitance bridge or by embedding it in a resonant circuit) and compare it with the room-temperature value near 5 pF; if the cold capacitance increases substantially, the low-capacitance claim does not survive at operating temperature.

Watch

Extended reading notes

Core claim

The paper's central claim is that the parasitic capacitance of a powder filter can be decoupled from its RF attenuation by spatial layering. In the layered filter, a copper wire is threaded through a thin polymer tube filled with Eccosorb CR-124 epoxy, and the inner walls of the copper chassis are also coated with the same metal-powder epoxy, leaving an air gap of about 1.5 mm between tube and chassis. That air gap, with relative permittivity near 1, makes the wire-to-chassis capacitance small, so the total parasitic capacitance is dominated by the SMA connectors and is roughly 5 pF for a 20 mm filter. The metal-powder layers still attenuate via the skin effect: transmission measurements show 30 to 40 dB attenuation above 10 GHz for the 20 mm filter, about 60 dB for a 40 mm filter, with essentially the same performance at 4.2 K as at room temperature. Inserted between a device and a cryogenic transimpedance amplifier, the layered filter preserves the flat transimpedance and noise floor up to about 1 MHz, whereas a conventional filter of the same length reduces the bandwidth by roughly an order of magnitude.

Load-bearing premise

The polymer tube and the air gap between the epoxy-coated conductor and the epoxy-coated chassis retain their dimensions and low dielectric constant at liquid-helium temperatures, so the parasitic capacitance that is measured at room temperature stays about 5 pF when the filter is cold; the paper verifies cryogenic attenuation but not cryogenic capacitance.

Editorial extensions

If this is right

  • A 20 mm layered filter gives 30–40 dB of attenuation above 10 GHz with about 5 pF of parasitic capacitance, roughly an order of magnitude less than a conventional filter of the same length.
  • A 40 mm layered filter reaches about 60 dB attenuation, and the attenuation spectrum is essentially unchanged when the filter is cooled to 4.2 K.
  • In a cryogenic transimpedance-amplifier measurement, the layered filter keeps the bandwidth and input-referred current noise nearly identical to the no-filter case, while the conventional filter cuts the bandwidth by about an order of magnitude.
  • Because the capacitance is dominated by the SMA connectors once the wire-to-chassis gap is large, further length increases add capacitance at only about 50 pF/m.
  • Such filters can suppress microwave heating of cryogenic samples without the usual penalty of degraded measurement bandwidth, which is directly relevant to quantum-device experiments.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • The room-temperature-only capacitance measurement leaves open whether the polymer tube and air gap keep their geometry at liquid-helium temperatures; a cryogenic capacitance measurement would settle this directly.
  • The same layering idea could be tuned to recover 50 Ω characteristic impedance—by adjusting gap width or epoxy thickness—which would extend the approach to RF applications where impedance matching matters.
  • Combining a layered filter with other filter stages (for example, RC or copper-powder filters) might give both strong low-frequency filtering and low capacitance at the amplifier input.
  • If capacitance stays low at millikelvin temperatures, filters could be placed closer to the device under test, shortening exposed wiring and reducing pickup.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

1 major / 4 minor

Summary. The paper reports a layered cryogenic powder filter in which a metal-powder-epoxy (Eccosorb CR-124) coating on the central conductor and on the inner chassis walls is separated by an air gap, in contrast to a conventional fully powder-filled filter. For a 20 mm layered filter, the authors measure roughly 5 pF parasitic capacitance versus about 50 pF for a conventional filter, and broadband attenuation of 30–40 dB above 10 GHz, increasing with length to about 60 dB at 40 mm and remaining essentially unchanged at 4.2 K. They then demonstrate in a cryogenic transimpedance-amplifier (TIA) setup that inserting the layered filter preserves the TIA bandwidth and noise floor, whereas a conventional filter degrades the bandwidth by roughly an order of magnitude. The central claim is that the multilayer design simultaneously achieves high RF attenuation and low parasitic capacitance, improving cryogenic measurement systems.

Significance. If the low-temperature capacitance claim holds, this is a useful engineering contribution to cryogenic measurement technology. The layered design is a simple modification of a well-established powder filter, achieves roughly a factor-of-40 reduction in parasitic capacitance per unit length while retaining significant GHz attenuation, and the TIA demonstration directly shows the practical benefit for MHz-band transport measurements. The paper's strengths include direct VNA transmission measurements, direct capacitance-bridge comparisons against a conventional filter, a cryogenic attenuation check at 4.2 K, and the use of a previously characterized homemade TIA (Ref. [19]) as an independent benchmark. The comparison is not model-dependent, and no free parameters are fitted to the main results.

major comments (1)
  1. [Fig. 4 and Section on TIA demonstration] The temperature of the filter in the TIA bandwidth demonstration is not stated. This is load-bearing because the paper's central advantage is low parasitic capacitance at cryogenic operating temperature, yet the capacitance reported in Fig. 2(c) was measured only at room temperature. If the layered and conventional filters in Fig. 4 were immersed in liquid helium, the preserved TIA bandwidth with the layered filter is direct system-level evidence that the low capacitance persists at 4.2 K, and the concern is largely resolved. If the filters were at room temperature, the cryogenic capacitance remains unverified, since attenuation (Fig. 3(c)) does not constrain capacitance. Please state explicitly where the filters were mounted and at what temperature, and, if possible, add a direct capacitance measurement at 4.2 K or a quantitative estimate for the polymer tube and air gap at low temperature.
minor comments (4)
  1. [Fig. 2(c) and length-dependence discussion] The capacitance data points appear to come from a single device per length, without error bars or repeated measurements. Because the linear fit and the quoted slopes (approximately 50 pF/m and 2 nF/m) are used to support the order-of-magnitude comparison, please state the number of devices measured and, if available, include measurement repeatability or uncertainty.
  2. [Fig. 3(c)] The cryogenic attenuation comparison is shown only for the 40 mm filter, while the TIA demonstration uses a 20 mm filter. A brief statement that the 20 mm filter's attenuation was also verified at 4.2 K, or a note that only the 40 mm was tested, would remove ambiguity about the length used in the application test.
  3. [Characteristic impedance paragraph] The statement that the layered filter has a typical characteristic impedance of approximately 65 Ω is asserted without showing a measurement or a calculation. Please provide the source of this number, whether from a TDR measurement, an impedance calculation from the geometry, or a simulation.
  4. [Author list] The author name appears as "Henri V o Van Qui" in the header; please correct the spacing/punctuation in the author list.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: all performance claims are direct measurements against external instruments and direct benchmark comparisons.

full rationale

The paper's central claims—high RF attenuation and low parasitic capacitance of the layered powder filter—are supported by direct measurements rather than by derived predictions from fitted parameters. The attenuation spectra in Fig. 3 are measured with a VNA (N5224B), and the parasitic capacitance in Fig. 2(c) is measured with a capacitance bridge (AH2700A); both are external instruments whose outputs are not constructed from the filter model. The comparison between layered and conventional filters is a head-to-head benchmark on the same test apparatus, and the TIA bandwidth/noise comparison in Fig. 4 is a direct system-level experiment, not a fitted consequence of the capacitance data. References [16]–[19] are prior characterizations of the homemade TIA; they serve as tool documentation for an instrument used in the comparison, not as the source of the filter's measured properties, and the filter result does not reduce to those references. The only evidence gap noted by a skeptical reading—capacitance measured at room temperature rather than at 4.2 K—is a completeness/correctness concern, not a circularity, because no prediction is derived from an assumed cryogenic capacitance value. Hence no self-definitional step, fitted-input-as-prediction, or load-bearing self-citation is present.

Assumptions & free parameters 0 free parameters · 4 assumptions · 0 invented entities

No new entities or fitted parameters. The design relies on standard EM skin-effect attenuation and coaxial capacitance formulas; the only unverified material assumption is the cryogenic behavior of the polymer tube and air gap.

assumptions (4)
  • domain assumption Skin effect in the metal-powder epoxy attenuates RF signals in the GHz range
    Invoked in the introduction and used to explain measured S21 attenuation.
  • domain assumption Parasitic capacitance of the layered filter is dominated by the air gap with relative permittivity near 1, giving about 50 pF/m
    Used to interpret the measured capacitance slope; standard capacitance formula for coaxial geometry.
  • standard math TIA noise and bandwidth model from Ref. [19] applies to the setup
    The TIA characterization is taken from the authors' prior work; it is independently published.
  • domain assumption Polymer tube remains mechanically stable and retains its dielectric properties at 4.2 K
    Assumed for cryogenic use, but not directly verified by capacitance measurement at low temperature.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Multilayer Cryogenic Powder Filters with Low Parasitic Capacitance." pith.science (2026). https://pith.science/paper/7Q5BYY7F

@misc{pith2026250723388,
  author       = {Pith},
  title        = {Pith review of: Multilayer Cryogenic Powder Filters with Low Parasitic Capacitance},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/7Q5BYY7F}},
  note         = {Machine review of arXiv:2507.23388}
}
read the original abstract

We report the development of a cryogenic powder filter that simultaneously offers high attenuation of radio-frequency (RF) signals in the gigahertz (GHz) range and minimized parasitic capacitance to ground. Conventional powder filters, which consist of a signal line passing through a metal powder-filled housing, attenuate high-frequency signals via the skin effect. However, these designs often suffer from significant parasitic capacitance between the signal line and the grounded chassis, which can compromise the performance of sensitive measurement setups by limiting their frequency bandwidth. In this work, we demonstrate that a multilayer powder filter design effectively achieves both high RF attenuation and reduced parasitic capacitance. This solution suppresses sample heating due to the unintentional intrusion of RF signals through the wiring, without degrading the performance of the measurement setup.

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

22 extracted references · 22 canonical work pages

  1. [19]

    Fast time -domain current measurement for quantum dot charge sensing using a homemade cryogenic transimpedance amplifier ,

    H. Bohuslavskyi, M. Hashisaka, T. Shimizu, T . Akiho, K . Muraki, and N. Kumada, “Fast time -domain current measurement for quantum dot charge sensing using a homemade cryogenic transimpedance amplifier ,” Appl. Phys. Lett. 121, 184003 (2022)

  2. [1]

    Coherent control of macroscopic quantum states in a single -Cooper-pair box ,

    Y. Nakamura, Y. A. Pashkin, and J. S. Tsai, “Coherent control of macroscopic quantum states in a single -Cooper-pair box ,” Nature 398, 786 (1999)

  3. [2]

    Superconducting circuits for quantum information: an outlook,

    M. H. Devoret and R. G. Schoelkopf, “Superconducting circuits for quantum information: an outlook,” Science 339, 1169 (2013)

  4. [3]

    Single -electron current sources: Toward a refined definition of the ampere,

    P. Pekola, O.-P. Saira, V. F. Maisi, A. Kemppinen, M. Möttönen, Y. A. Pashkin, and D. V. Averin, “Single -electron current sources: Toward a refined definition of the ampere,” Rev. Mod. Phys. 85, 1421 (2013)

  5. [4]

    Quantum supremacy using a programmable superconducting processor,

    F. Arute, K. Arya, R. Babbush , et al ., “Quantum supremacy using a programmable superconducting processor,” Nature 574, 505 (2019)

  6. [5]

    Semiconductor spin qubits ,

    G. Burkard, T. D. Ladd, A. Pan, J. M. Nichol, and J. R. Petta, “Semiconductor spin qubits ,” Rev. Mod. Phys. 95, 025003 (2023)

  7. [6]

    Miniature electrical filters for single electron devices,

    D. Vion, P. F. Orfila, P. Joyez, D. Esteve, and M. H. Devoret, “Miniature electrical filters for single electron devices,” J. Appl. Phys. 77, 2519 (1995)

  8. [7]

    Noise measurement system at electron temperature down to 20 mK with combinations of the low pass filters,

    M. Hashisaka, Y . Yamauchi, K . Chida, S . Nakamura, K . Kobayashi, and T. Ono, “Noise measurement system at electron temperature down to 20 mK with combinations of the low pass filters,” Rev. Sci. Instrum. 80, 096105 (2009)

Show all 22 references
  1. [8]

    Experimental tests for the quantum behavior of a macroscopic degree of freedom: The phase difference across a Josephson junction,

    J. M. Martinis, M. H. Devoret, and J. Clarke, “Experimental tests for the quantum behavior of a macroscopic degree of freedom: The phase difference across a Josephson junction,” Phys. Rev. B 35, 4682 (1987)

  2. [9]

    Comparison of cryogenic filters for use in single electronics experiments,

    K. Bladh, D. Gunnarsson, E. Hürfeld, S. Devi, C. Kristoffersson, B. Smålander, S. Pehrson, T. Claeson, P. Delsing, and M. Taslakov, “Comparison of cryogenic filters for use in single electronics experiments,” Rev. Sci. Instrum. 74, 1323 (2003)

  3. [10]

    Lukashenko and A

    A. Lukashenko and A. V. Ustinov, “Improved powder filters Fig. 4 Application example for a cryogenic transport measurement. (a) Schematic of the measurement setup. We examined the influence of fabricated filters inserted between DUT and TIA by evaluating the bandwidth and nois...

  4. [11]

    Printed circuit board metal powder filters for low electron temperatures,

    F. Mueller, R. N. Schouten, M. Brauns, T. Gang, W. H. Lim, N. S. Lai, A. S. Dzurak, W. G. van der Wiel, and F. A. Zwanenburg, “Printed circuit board metal powder filters for low electron temperatures,” Rev. Sci. Instrum. 84, 044706 (2013)

  5. [12]

    Silver- epoxy microwave filters and thermalizers for millikelvin experiments,

    C. P. Scheller, S. Heizmann, K. Bedner, D. Giss, M. Meschke, D. M. Zumbühl, J. D. Zimmerman, and A. C. Gossard, “Silver- epoxy microwave filters and thermalizers for millikelvin experiments,” Appl. Phys. Lett. 104, 211106 (2014)

  6. [13]

    Comparison of cryogenic low -pass filters,

    M. Thalmann, H. -F. Pernau, C. Strunk, E. Scheer, and T. Pietsch, “Comparison of cryogenic low -pass filters,” Rev. Sci. Instrum. 88, 114703 (2017)

  7. [14]

    Absorptive filters for quantum circuits: Efficient fabrication and cryogenic power handling,

    A. Paquette, J. Griesmar, G. Lavoie, R. Albert, F. Blanchet, A. Grimm, U . Martel, and M. Hofheinz, “Absorptive filters for quantum circuits: Efficient fabrication and cryogenic power handling,” Appl. Phys. Lett. 121, 124001 (2022)

  8. [15]

    Robust cryogenic matched low-pass coaxial filters for quantum computing applications ,

    A. I. Ivanov, V. I. Polozov, V. V. Echeistov, A. A. Samoylov, E. I. Malevannaya, A . R. Matanin, N . S. Smirnov, and I. A. Rodionov, “Robust cryogenic matched low-pass coaxial filters for quantum computing applications ,” Appl. Phys. Lett. 123, 204001 (2023)

  9. [16]

    Cross -correlation measurement of quantum shot noise using homemade transimpedance amplifiers,

    M. Hashisaka, T. Ota, M. Yamagishi, T. Fujisawa, and K. Muraki, “Cross -correlation measurement of quantum shot noise using homemade transimpedance amplifiers,” Rev. Sci. Instrum. 85, 054704 (2014)

  10. [17]

    Homemade - HEMT-based transimpedance amplifier for high-resolution shot- noise measurements,

    T. Shimizu, M. Hashisaka, H. Bohuslavskyi, T. Akiho, N. Kumada, S. Katsumoto, and K. Muraki, “Homemade - HEMT-based transimpedance amplifier for high-resolution shot- noise measurements,” Rev. Sci. Instrum. 92, 124712 (2021)

  11. [18]

    Shot noise in mesoscopic systems: From single particles to quantum liquids,

    K. Kobayashi and M. Hashisaka, “Shot noise in mesoscopic systems: From single particles to quantum liquids,” J. Phys. Soc. Jpn. 90, 102001 (2021)

  12. [20]

    50 Ω Characteristic impedance low-pass metal powder filters,

    F. P. Milliken, J. R. Rozen, G. A. Keefe, and R. H. Koch, “50 Ω Characteristic impedance low-pass metal powder filters,” Rev. Sci. Instrum. 78, 024701 (2007)

  13. [21]

    Impedance matched absorptive thermal blocking filters,

    E. J. Wollack, D. T. Chuss, K. Rostem, and K. U -Yen, “Impedance matched absorptive thermal blocking filters,” Rev. Sci. Instrum. 85, 034702 (2014)

  14. [22]

    Impedance -matched coplanar -waveguide metal - powder low-pass filters for cryogenic applications,

    M. Lyatti, R. Roth, I. Gundareva, D. Grützmacher, and T. Schäpers, “Impedance -matched coplanar -waveguide metal - powder low-pass filters for cryogenic applications,” Rev. Sci. Instrum. 95, 074708 (2024)

Pith tools

Reviewed August 6, 2026 · model on record in the stance chip above.