Pith. sign in

REVIEW 2 cited by

Linearized nonequilibrium dynamics in nonconformal plasma

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 1503.07149 v1 pith:YJ27CGYL submitted 2015-03-24 hep-th hep-phnucl-th

classification hep-thhep-phnucl-th
keywords nonhydrodynamicconformalitycrossoverdampingdegreesdynamicsfindfreedom
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

We investigate the behaviour of the lowest nonhydrodynamic modes in a class of holographic models which exhibit an equation of state closely mimicking the one determined from lattice QCD. We calculate the lowest quasinormal mode frequencies for a range of scalar self-interaction potentials and find that the damping of the quasinormal modes at the phase transition/crossover falls off by a factor of around two from conformality after factoring out standard conformal temperature dependence. The damping encoded in the imaginary part of the frequencies turns out to be correlated with the speed of sound and is basically independent of the UV details of the model. We also find that the dynamics of the nonhydrodynamic degrees of freedom remains ultralocal, even to a higher degree, as we deviate from conformality. These results indicate that the role of nonhydrodynamic degrees of freedom in the vicinity of the crossover transition may be enhanced.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Quasinormal modes of nonthermal fixed points

    hep-th 2025-02 conditional novelty 8.0 of 10

    Perturbations around nonthermal fixed points obey a quasinormal-mode eigenvalue problem, and for a Fokker-Planck collision kernel the spectrum is a tower of purely imaginary frequencies.

  2. Domain Walls From Confining Bubbles: $SU(N_{c})$ Yang Mills at Finite $\theta$

    hep-ph 2026-07 conditional novelty 6.0 of 10

    A nonzero theta angle weakens supercooling in SU(Nc) Yang-Mills confinement and makes any resulting domain-wall gravitational-wave signal invisible except under severe fine-tuning.

Pith tools