Pith. sign in

REVIEW 2 cited by

Propagating spin-wave normal modes: A dynamic matrix approach using plane-wave demagnetizating tensors

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 1611.06153 v1 pith:WXB2ZZRO submitted 2016-11-18 cond-mat.mes-hall

classification cond-mat.mes-hall
keywords magneticdynamicspin-wavesinteractionspropagatingapproachdemagnetizationfactors
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

We present a finite-difference micromagnetic approach for determining the normal modes of spin-waves propagating in extended magnetic films and strips, which is based on the linearized Landau-Lifshitz equation and uses the dynamic matrix method. The model takes into account both short range exchange interactions and long range dipole-dipole interactions. The latter are accounted for through plane-wave dynamic demagnetization factors, which depend not only on the geometry and relative positions of the magnetic cells, as usual demagnetization factors do, but also on the wave vector of the propagating waves. Such a numerical model is most relevant when the spin-wave medium is spatially inhomogeneous perpendicular to the direction of propagation, either in its magnetic properties or in its equilibrium magnetic configuration. We illustrate this point by studying surface spin-waves in magnetic bilayer films and spin-waves channelized along magnetic domain walls in perpendicularly magnetized strips. In both cases, dynamic dipolar interactions produce non-reciprocity effects, where counter-propagative spin-waves have different frequencies.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Spin-wave softening across the uniform-to-stripe domain transition in iron garnet film

    cond-mat.mes-hall 2026-07 conditional novelty 6.0 of 10

    In a perpendicular-anisotropy BiYIG film, the spin-wave branch that softens at a finite wavevector before the uniform-to-stripe transition has a wavelength matching the stripe period, and new modes appear in the stripe state.

  2. Nonreciprocal spin-wave dispersion in magnetic bilayers

    cond-mat.mes-hall 2024-12 conditional novelty 5.0 of 10

    BLS measurements validate TETRAX simulations of spin-wave dispersions in CoFeB/NiFe bilayers, and the simulations show how layer thickness and magnetization tune nonreciprocity to a maximum of 5.2 GHz.

Pith tools