Pith. sign in

REVIEW 3 cited by

Gravity from entropy

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2408.14391 v7 pith:K742245C submitted 2024-08-26 gr-qc cond-mat.stat-mechhep-thquant-ph

classification gr-qccond-mat.stat-mechhep-thquant-ph
keywords mattermetricactionfieldsg-fieldgravityspacetimeentropic
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Gravity is derived from an entropic action coupling matter fields with geometry. The fundamental idea is to relate the metric of Lorentzian spacetime to a quantum operator, playing the role of an renormalizable effective density matrix and to describe the matter fields topologically, according to a Dirac-K\"ahler formalism, as the direct sum of a zero-form, a one-form and a two-form. While the geometry of spacetime is defined by its metric, the matter fields can be used to define an alternative metric, the metric induced by the matter fields, which geometrically describes the interplay between spacetime and matter. The proposed entropic action is the quantum relative entropy between the metric of spacetime and the metric induced by the matter fields. The modified Einstein equations obtained from this action reduce to the Einstein equations with zero cosmological constant in the regime of low coupling. By introducing the G-field, which acts as a set of Lagrangian multipliers, the proposed entropic action reduces to a dressed Einstein-Hilbert action with an emergent small and positive cosmological constant only dependent on the G-field. The obtained equations of modified gravity remain second order in the metric and in the G-field. A canonical quantization of this field theory could bring new insights into quantum gravity while further research might clarify the role that the G-field could have for dark matter.

Discussion (0). Sign in to comment.

Forward citations

Cited by 3 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Vacuum Gravity from Entropy: Stability, Spectra, and Exact Waves

    gr-qc 2026-07 accept novelty 7.0 of 10

    The vacuum sector of Gravity from Entropy reduces at quadratic order to Einstein gravity plus RμνRμν terms, and the resulting linear spectrum contains a tachyonic opposite-residue spin-2 pole for the foundational coup...

  2. Spherically symmetric black holes in Gravity from Entropy and spontaneous emission

    gr-qc 2026-02 unverdicted novelty 7.0 of 10

    In the Gravity from Entropy framework, spherically symmetric black holes acquire r^{-4} corrections to Schwarzschild geometry, with large-mass evaporation at constant rate -β/24 and intermediate-mass loss following th...

  3. How greedy is the Universe? An entropy ledger and a causal envelope for early black hole growth

    gr-qc 2026-07 conditional novelty 6.0 of 10

    Horizon entropy dominates the cosmic ledger by ~16 orders of magnitude, but the realized entropy production rate is only 10^-5±1.5 of the causal-hydrodynamic envelope at z=4–12.

Pith tools