Pith. sign in

REVIEW 5 cited by

High-fidelity heralded quantum state preparation and measurement

Not yet reviewed by Pith; the record is open.

Re-run · record.json Download PDF Read on arXiv ↗

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2409.05805 v1 pith:KYJZS5CY submitted 2024-09-09 quant-ph physics.atom-ph

A. S. Sotirova , J. D. Leppard , A. Vazquez-Brennan , S. M. Decoppet , F. Pokorny , M. Malinowski , C. J. Ballance This is my paper · ORCID
classification quant-phphysics.atom-ph
keywords qubitprotocolspamtimesdetecthigh-fidelitylevelmeasurement
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
abstract

We present a novel protocol for high-fidelity qubit state preparation and measurement (SPAM) that combines standard SPAM methods with a series of in-sequence measurements to detect and remove errors. The protocol can be applied in any quantum system with a long-lived (metastable) level and a means to detect population outside of this level without coupling to it. We demonstrate the use of the protocol for three different qubit encodings in a single trapped $^{137}\mathrm{Ba}^+$ ion. For all three, we achieve the lowest reported SPAM infidelities of $7(4) \times 10^{-6}$ (optical qubit), $5(4) \times 10^{-6}$ (metastable-level qubit), and $8(4) \times 10^{-6}$ (ground-level qubit).

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 5 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Microwave-driven same-species sympathetic cooling for trapped ions

    quant-ph 2026-07 accept novelty 8.0 of 10

    Microwave-driven sympathetic cooling with same-isotope 43Ca+ ions cools a shared motional mode to n̄≈0.16 with 1.7(4)×10^-4 data-qubit error per cycle.

  2. Quantum logic operations and algorithms in a single 25-level atomic qudit

    quant-ph 2025-07 conditional novelty 7.0 of 10

    A single 137Ba+ ion acts as a 25-level qudit with 99.51% heralded SPAM fidelity, and runs Bernstein-Vazirani and Toffoli circuits on up to four virtual qubits.

  3. Qubit Loss Inference with Stabilizer Codes without Leakage Detection Units

    quant-ph 2026-07 conditional novelty 6.0 of 10

    Loss locations can be inferred from repeated stabilizer syndrome data alone when punctured stabilizer checks anticommute, matching or beating noisy LDU-based correction at low loss rates.

  4. Efficient Implementation of a Quantum Algorithm with a Trapped Ion Qudit

    quant-ph 2025-06 conditional novelty 6.0 of 10

    First implementation of Grover's search on trapped-ion qudits of dimension 5 and 8, with measured success probabilities of 96.8% and 69%.

  5. Spontaneous Raman scattering from metastable states of Ba$^+$

    quant-ph 2025-05 conditional novelty 6.0 of 10

    Measurements of spontaneous Raman scattering from metastable 137Ba+ states agree with the Moore et al. model, supporting predictions of low gate errors at large detunings.

Pith tools