Pith. sign in

REVIEW 3 major objections 4 minor 50 references

New Agegraphic Dark Energy Driven Reconstruction of \boldmath{$f(Q)$} Gravity and its Cosmological Implications

T0 review · 3 major / 4 minor · reviewed 2026-08-06 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read A reconstructed f(Q) gravity from the new agegraphic dark energy correspondence fits BAO expansion data better than ΛCDM and needs no cosmological constant.

desk verdict Algebra error in the reconstruction: Eq. (23) does not solve the paper's own NADE ODE, so the fitted f(Q) is not the NADE model claimed. read the letter →

arxiv 2507.00878 v1 pith:7JYXFJVI submitted 2025-07-01 astro-ph.CO

Rajdeep Mazumdar , Kalyan Malakar , Mrinnoy M. Gohain , Kalyan Bhuyan This is my paper
classification astro-ph.CO PACS 98.80.-k04.50.Kd95.36.+x
keywords f(Q)gravitynewagegraphicdarkenergycosmologicalreconstructionlate-timeaccelerationbaryonacousticoscillationsquintessencenon-metricityscalarMCMC
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper aims to establish that the universe's late-time acceleration can be produced by a reconstructed modified-gravity function $f(Q)$, built from the new agegraphic dark energy (NADE) correspondence, without a cosmological constant. It chooses a power-law scale factor $a(t)=a_0 t^h$, identifies the geometric dark-energy density of $f(Q)$ gravity with the NADE density, solves the resulting differential equation for $F(Q)$ in $f(Q)=Q+F(Q)$, and fixes the integration constant by the condition $H(z=0)=H_0$. Fitting the free parameters to baryon acoustic oscillation measurements of the Hubble parameter, the model matches the data with higher $R^2$ and lower $\chi^2_{\min}$, AIC, and BIC than the standard ΛCDM model. It predicts a present deceleration parameter in $[-0.5879,-0.3333]$, a quintessence-like effective equation of state with $-1<\omega_{\mathrm{eff}}<-1/3$, and a negative $\mathrm{Om}(z)$ slope, and it reduces to general relativity as $h\to 1$ and $C_1\to 0$.

What carries the argument

The central object is the reconstructed function $f(Q)=Q+F(Q)$ obtained from the NADE correspondence. The key identity is the first-order linear equation $F-2QF_Q=6n^2/\eta^2$, where conformal time is mapped to $Q=6H^2$ through the power-law scale factor, $\eta=t^{1-h}/[a_0(1-h)]$. Solving it produces the closed form of Eq. (23): a $\sqrt{Q}$ prefactor times a term proportional to $(h\sqrt{Q})^{2h-1}$ plus an integration constant $C_1$, with the geometric dark-energy density given by $\rho_{\mathrm{de}}=F/2-QF_Q$. This $F$ enters the modified Friedmann equation that fixes $H(z)$, and the boundary condition $H(0)=H_0$ ties $C_1$ to the fitted parameters $(H_0,\Omega_{m0},a_0,h,n)$.,

What would settle it

Measure $H(z)$ with cosmic chronometers or independent distance indicators at redshifts above the fitted range and test whether $\ln H(z)$ is a straight line in $\ln(1+z)$ with slope $1/h$; any significant deviation from that single power law breaks the conformal-time-to-$Q$ mapping and falsifies the reconstructed $f(Q)$.

Watch

Extended reading notes

Core claim

The central claim is that the explicit function $f(Q)=Q+F(Q)$ with $F$ solving $F(Q)-2Q F_Q = 6n^2/\eta^2$ under the power-law expansion $a(t)=a_0 t^h$ is an observationally consistent alternative to ΛCDM. The paper reads the NADE density $\rho_{\mathrm{NADE}}=3n^2M_P^2/\eta^2$ as the geometric dark-energy density $\rho_{\mathrm{de}}=F/2-QF_Q$, uses $Q=6H^2$ to express conformal time $\eta$ in terms of $Q$, and solves the resulting first-order equation for $F(Q)$. The solution is then inserted into the modified Friedmann equation, the constant $C_1$ is fixed by $H(0)=H_0$, and the remaining parameters are constrained by MCMC on BAO Hubble data. With the best-fit values, the model's $H(z)$ tracks the data with $R^2>0.98$, yields $q(0)\in[-0.5879,-0.3333]$ with transition redshift $z_{\mathrm{tr}}\sim0.52$-$0.81$, keeps $-1<\omega_{\mathrm{eff}}<-1/3$, and shows a negative $\mathrm{Om}(z)$ slope; in the limit $h\to1$, $C_1\to0$, it returns $f(Q)\to Q$, the general-relativity limit.

Load-bearing premise

The reconstruction assumes the expansion history is exactly a power law $a(t)=a_0t^h$ and that the geometric dark-energy density equals the NADE density $\rho_{\mathrm{NADE}}$; if either assumption is false, the derived $f(Q)$ is not the $f(Q)$ of the actual universe.

Editorial extensions

If this is right

  • The reconstructed model provides a concrete $f(Q)$ action whose vacuum limit is general relativity, so the geometric term alone can drive late-time acceleration.
  • It predicts a deceleration-acceleration transition at $z_{\mathrm{tr}}\sim0.52$-$0.81$ and a present $q(0)$ in $[-0.5879,-0.3333]$, consistent with an accelerating universe.
  • Its effective equation of state lies in the quintessence band $-1<\omega_{\mathrm{eff}}<-1/3$ and its $\mathrm{Om}(z)$ slope is negative, distinguishing it geometrically from a cosmological constant.
  • The energy conditions take the expected acceleration signature: NEC, WEC, and DEC hold while SEC is violated only at low redshift.
  • On the BAO datasets used, AIC and BIC differences favor the reconstructed model over ΛCDM, which the paper interprets as statistical support for the model.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Beyond the paper, repeating the reconstruction with a non-power-law expansion template would isolate how much of the good fit comes from the power-law ansatz rather than from the NADE-to-$f(Q)$ correspondence itself.
  • If the model is taken at face value, its $H(z)$ continues as a pure power law at all redshifts, so high-redshift Hubble measurements outside the fitted sample give a sharp, model-independent test.
  • The natural next extension is linear perturbation theory: the reconstructed $F(Q)$ fixes $f_{QQ}$, and redshift-space-distortion data could check whether structure growth agrees with the quintessence-like expansion history.
  • A complementary check would be to use the same conformal-time NADE density to reconstruct other geometric dark-energy actions, exposing whether the reported advantage over ΛCDM is specific to $f(Q)$ gravity.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 4 minor

Summary. The paper reconstructs a specific f(Q) gravity model from the New Agegraphic Dark Energy (NADE) correspondence using a power-law scale factor a(t)=a0 t^h. It derives an analytic form F(Q), fits the free parameters to BAO Hubble data via MCMC, and reports statistical preference over ΛCDM, along with diagnostics (deceleration parameter, effective EoS, Om) and energy conditions. The central claim is that this NADE-motivated f(Q) model is a viable, observationally consistent alternative to ΛCDM without a cosmological constant.

Significance. If the derivation and fits were correct, the paper would provide a concrete realization of modified gravity sourced by a quantum-motivated dark energy density, with a falsifiable expansion history. The statistical comparison to ΛCDM and the diagnostic analyses are useful in principle. However, the central algebraic step contains errors that invalidate the reconstructed f(Q) and therefore all subsequent fits and conclusions. The paper's methodology is standard in the reconstruction literature, and the idea is salvageable, but the present results do not support the claims.

major comments (3)
  1. [III, Eqs. (22)-(23)] The reconstructed F(Q) in Eq. (23) does not solve the differential equation it is meant to satisfy. Writing F(Q)=C1 sqrt(Q)+A h^{2h-1} Q^h with A=6 a0^2 (h-1)^2 n^2/(2h-1), direct substitution gives F - 2 Q F' = -A(2h-1) h^{2h-1} Q^h = -6 a0^2 (h-1)^2 n^2 h^{2h-1} Q^h. This is proportional to Q^h, whereas the right-hand side of Eq. (22), taken as printed, is proportional to Q^{h-1}. The proposed solution is therefore not a solution of the reconstruction equation, and the error propagates through Eqs. (30)-(31) and all derived cosmological quantities.
  2. [III, Eqs. (21)-(22)] The mapping from conformal time to Q is incorrect in Eq. (22). From Eq. (21), eta = (6 h^2/Q)^{(1-h)/2} / [a0(1-h)], so 1/eta^2 = a0^2 (1-h)^2 (6 h^2/Q)^{h-1}, not a0^2 (1-h)^2 (6 h^2/Q)^{1-h} as written. Thus even the intended correspondence in Eq. (18) is not transcribed correctly; the exponent is reversed. A correct reconstruction would give a particular solution proportional to Q^{1-h} (or Q^{h-1} for the printed equation), not Q^h.
  3. [V, Eqs. (30)-(31)] Because F(Q) is wrong, the Hubble parameter in Eq. (30) is not the H(z) implied by the assumed scale factor a(t)=a0 t^h. Eq. (29) gives H(z)=H0(1+z)^{1/h}, but Eq. (30) is an independent expression; the two are inconsistent unless the parameters satisfy a non-trivial constraint. The MCMC fits, chi-square and AIC/BIC values, and the diagnostics q(z), omega_eff(z), Om(z), and energy conditions are therefore computed for a model that is not the NADE-reconstructed f(Q) gravity claimed in the paper. The central claim of observational viability is unsupported.
minor comments (4)
  1. [Table III] The third data row for the new model is labeled 'DESI' but should read 'DESI + P-BAO' to match the text and the ΛCDM rows.
  2. [Abstract and Table IV] The abstract quotes q(0) in [-0.5879, -0.3333], but Table IV gives central values such as -0.4330, -0.4480, -0.4361; the range appears to be the 2-sigma or full posterior range, but this is not stated explicitly.
  3. [Throughout] There are numerous typographical and grammatical issues, including 'along with motivate', 'constraint' used as a verb, inconsistent spacing in 'f (Q)' and 'ωeff (z)', and a figure caption in Fig. 2 that refers to parameters 'ω0 and ω1' that are not defined.
  4. [Eq. (30)] The equation is written in a needlessly opaque form with expressions like 'p H_0^2 (1+z)^{2/h}'; it should be simplified and clearly defined in terms of the parameters and z before fitting.

Circularity Check

2 steps flagged · score 6.0 of 10

The reconstructed f(Q) is engineered to reproduce the input NADE density by Eq. (18), and the reported diagnostics are reparametrizations of the fitted power-law index; the central fit tests the assumed H(z) template, not an independent prediction of the reconstructed gravity theory.

  1. self definitional [Sec. III, Eqs. (12), (16), and (18)]
    "Combining Eq. (16) and Eq. (12) we obtain a differential equation for f(Q): F(Q) − 2QFQ = 6 n^2 / η^2."

    This equation is obtained by equating the geometric dark-energy density ρ_de = F/2 − QF_Q (Eq. 12) with the NADE density ρ_NADE = 3n^2/η^2 (Eq. 16). Solving Eq. (18) then determines F(Q), so the resulting f(Q)=Q+F(Q) is constructed, by definition, to reproduce the input NADE density. Any later statement that the model contains a geometrically motivated dark-energy component with NADE behavior is a restatement of this assumed correspondence, not a derived consequence of f(Q) gravity. The direction of implication is fixed by the reconstruction setup: the gravity function is chosen to yield the assumed dark-energy density, so the NADE content is not an independent output.

  2. fitted input called prediction [Sec. V, Eqs. (29), (30), and (25)-(27)]
    "using the scale factor given by Eq. (19), we can obtain the Hubble parameter as: H(z) = H0(1+z)^{1/h} ... Finally using Eq. (30) along with Eqs. (31), (25), (26), and (27), we can obtain the deceleration parameter, effective EoS, and Om diagnostics."

    The Hubble template fitted to the BAO data is the same power-law scale factor used as input to the reconstruction: Eq. (19) directly gives Eq. (29). The diagnostic quantities q(z), ω_eff(z), and Om(z) are then computed from this fitted template through Eqs. (25)-(27). In particular, for Eq. (29), q(0) = −1 + 1/h depends only on the fitted index h, so the quoted intervals for q(0), ω_eff(0), and z_tr are reparametrizations of the fitted power-law index rather than independent predictions of the reconstructed f(Q) theory. The reported goodness of fit therefore validates the assumed power-law/NADE ansatz; the reconstructed F(Q) enters only through substitution into Eq. (30), not through a separately tested dynamical prediction.

full rationale

The main circularity is the reconstruction loop: the paper assumes ρ_de = ρ_NADE (Eq. 18) and a power-law scale factor (Eq. 19), solves for F(Q) from that input, and then uses the same scale factor to write H(z)=H0(1+z)^{1/h} (Eq. 29). Fitting that H(z) to BAO data and presenting q(0), ω_eff(0), z_tr, and Om(z) as implications of the reconstructed f(Q) model makes the 'predictions' functions of the fitted input rather than independent outputs. The central viability claim thus reduces, to a substantial degree, to fitting the power-law/NADE ansatz. There is no load-bearing self-citation chain; the references to other reconstruction papers are contextual, not justificatory for the present derivation. Separately, direct substitution indicates that Eq. (23) does not satisfy the defining equation (18)/(22): for the Q^h part of F(Q), F−2QF_Q produces a term proportional to Q^h, whereas the RHS of Eq. (22) requires a different power. That is a mathematical consistency defect rather than a circularity, and it is not the basis for the circularity score. The score of 6 reflects that several reported diagnostics reduce by construction to the fitted power-law index and that the reconstructed f(Q) is defined to reproduce the assumed NADE density, while the model comparison and the algebraic form of F(Q) still contain some non-tautological content.

Assumptions & free parameters 5 free parameters · 5 assumptions · 0 invented entities

The model's predictive content rests on the NADE density and the power-law ansatz; the f(Q) function is a derived rewriting, and the five fitted parameters (H0, Omega_m0, a0, h, n) are the degrees of freedom of that input model. No new entities are postulated.

free parameters (5)
  • h (power-law index) = 0.751 +/- 0.170 (DESI), 0.757 +/- 0.174 (combined)
    Fixes the expansion history H = h/t and the conformal time mapping (Eqs 19-21); fitted to BAO data.
  • n (NADE dimensionless parameter) = 3.401 +/- 1.119 (DESI), 2.808 +/- 1.434 (combined)
    Sets the NADE energy density scale rho_NADE = 3 n^2 / eta^2 (Eq 16); fitted to BAO data.
  • a0 (scale factor normalization) = 1.251 +/- 0.510 (DESI), 1.241 +/- 0.514 (combined)
    Enters conformal time eta through (1 - h) a0; redundant with the normalization a(t0) = 1 and degenerate with n, yet fitted as a free parameter.
  • Omega_m0 (matter density parameter) = 0.306 +/- 0.044 (DESI), 0.290 +/- 0.017 (combined)
    Standard matter density parameter fitted to BAO data.
  • H0 (Hubble constant) = 67.17 +/- 3.24 (DESI), 66.59 +/- 1.43 (combined)
    Present Hubble parameter fitted to BAO data. C1 is fixed by the z = 0 condition (Eq 31), so it is not a free parameter.
assumptions (5)
  • domain assumption Power-law scale factor a(t) = a0 t^h (Eq 19)
    The entire reconstruction of F(Q) uses H(t) = h/t and the resulting eta(Q) mapping; if the true expansion history is not power-law, the reconstructed f(Q) has no content.
  • domain assumption NADE energy density rho_NADE = 3 n^2 M_P^2 / eta^2 (Eq 16) with conformal-time IR cutoff
    Taken from Wei and Cai 2008 [14]; it is the input dark energy model, not derived in this paper.
  • ad hoc to paper Correspondence rho_de = rho_NADE (Eq 18)
    The geometric dark energy from f(Q) is set equal to the NADE density by hand; this is the reconstruction ansatz and makes the f(Q) form a rewriting of NADE.
  • domain assumption Non-interacting radiation, matter, and geometric DE components (Eq 14)
    Standard assumption in the f(Q) cosmological reconstruction literature; no interaction terms.
  • standard math Flat FLRW metric and coincident gauge (Eq 6)
    Standard setup in symmetric teleparallel cosmology; Q = 6 H^2 follows.

how reviews work

0 comments
Cite this review

Pith. "Pith review of New Agegraphic Dark Energy Driven Reconstruction of \boldmath{$f(Q)$} Gravity and its Cosmological Implications." pith.science (2026). https://pith.science/paper/7JYXFJVI

@misc{pith2026250700878,
  author       = {Pith},
  title        = {Pith review of: New Agegraphic Dark Energy Driven Reconstruction of \boldmath$f(Q)$ Gravity and its Cosmological Implications},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/7JYXFJVI}},
  note         = {Machine review of arXiv:2507.00878}
}
abstract

In this work, we perform reconstruction of \( f(Q) \) gravity inspired by the New Agegraphic Dark Energy (NADE) model, aiming to account for the Universe's late time acceleration without invoking a cosmological constant. Utilizing a power law scale factor \( a(t) = a_0 t^h \), we derive an analytic form for \( f(Q) \) based on a correspondence with NADE, where the conformal time serves as the infrared cutoff. The resulting model naturally recovers General Relativity in the limit and exhibits a geometrically motivated dark energy component. We constrain the model parameters using recent Baryon Acoustic Oscillation (BAO) data from DESI DR2 BAO and previous BAO observations through the Markov Chain Monte Carlo (MCMC) analysis. The reconstructed Hubble parameter \( H(z) \) demonstrates excellent agreement with observational data, achieving high \( R^2 \) values and low \(\chi^2_{\min}\), AIC, and BIC scores, outperforming the standard \( \Lambda \)CDM model. Further, we investigate the cosmological evolution using the deceleration parameter \( q(z) \), effective equation of state \( \omega_{\mathrm{eff}}(z) \), and Om diagnostics. The model exhibits a clear transition from deceleration to acceleration with a present value \( q(0) \in \left[-0.5879, -0.3333\right] \) and transition redshift $z_{\mathrm{tr}} \sim 0.5209-0.8126$, while maintaining \( -1 < \omega_{\mathrm{eff}}(z) < -1/3 \), indicating quintessence like behavior. Om diagnostics consistently show a negative slope, further confirming deviation from \( \Lambda \)CDM. Energy condition analysis reveals that WEC, DEC, and NEC are satisfied, while SEC is violated only at low redshifts which is consistent with cosmic acceleration. Overall, the reconstructed \( f(Q) \) model provides a viable, observationally consistent, and theoretically motivated alternative to standard dark energy scenarios.

Figures

Figures reproduced from arXiv: 2507.00878 by the authors.

Figure 1
Figure 1. FIG. 1. Plot of [PITH_FULL_IMAGE:figures/full_fig_p008_1.png] view at source ↗
Figure 2
Figure 2. FIG. 2. 2-d contour sub-plot for the parameters [PITH_FULL_IMAGE:figures/full_fig_p009_2.png] view at source ↗
Figure 3
Figure 3. FIG. 3. Evolution of deceleration parameter with redshift with best model parameters for the first model. The shaded regions [PITH_FULL_IMAGE:figures/full_fig_p010_3.png] view at source ↗
Figures from the paper (3 more)
Figure 4
Figure 4. Figure 4: FIG. 4. Evolution of effective EoS with redshift with best model parameters for the first model. The shaded regions here [PITH_FULL_IMAGE:figures/full_fig_p010_4.png]
Figure 5
Figure 5. Figure 5: FIG. 5. Evolution of [PITH_FULL_IMAGE:figures/full_fig_p011_5.png]
Figure 6
Figure 6. Figure 6: FIG. 6. Evolution of deceleration parameter , effective EoS and [PITH_FULL_IMAGE:figures/full_fig_p012_6.png]

Discussion (0). Sign in to comment.

Reference graph

Works this paper leans on

50 extracted references · 10 canonical work pages

  1. [18]

    Reconstructingf (R) modified gravity from entropy-corrected versions of holographic and new agegraphic dark energy models,

    K. Karami and M. S. Khaledian, “Reconstructingf (R) modified gravity from entropy-corrected versions of holographic and new agegraphic dark energy models,”JHEP, 03, 086 (2011)

    work page 2011

  2. [28]

    A Cosmological Holographic Reconstruction of f(Q) Theory

    P. Saha and P. Rudra, “A Cosmological Holographic Reconstruction of f (Q) Theory,” arXiv:2407.01870v2 (2025), arXiv:2407.01870 [gr-qc]

    work page Pith review arXiv 2025

  3. [1]

    Observational evidence from supernovae for an accelerating universe and a cosmological constant,

    A. G. Riess et al., “Observational evidence from supernovae for an accelerating universe and a cosmological constant,” Astron. J. 116, 1009 (1998), arXiv:astro-ph/9805201

    arXiv 1998

  4. [2]

    Measurements of Omega and Lambda from 42 high-redshift supernovae,

    S. Perlmutter et al., “Measurements of Omega and Lambda from 42 high-redshift supernovae,”Astrophys. J. 517, 565 (1999), arXiv:astro-ph/9812133

    arXiv 1999

  5. [3]

    The Supernova Legacy Survey: Measurement ofΩM, ΩLambda and ω from the first year data set,

    P. Astier et al., “The Supernova Legacy Survey: Measurement ofΩM, ΩLambda and ω from the first year data set,”Astron. Astrophys. 447, 31 (2006), arXiv:astro-ph/0510447

    arXiv 2006

  6. [4]

    First-Year Wilkinson Microwave Anisotropy Probe (WMAP) Observations: Determination of Cos- mological Parameters,

    D. N. Spergel et al., “First-Year Wilkinson Microwave Anisotropy Probe (WMAP) Observations: Determination of Cos- mological Parameters,” Astrophys. J. Suppl. Ser. 148, 175 (2003), arXiv:astro-ph/0302209

    arXiv 2003

  7. [5]

    Cosmological parameters from SDSS and WMAP,

    M. Tegmark et al., “Cosmological parameters from SDSS and WMAP,”Phys. Rev. D 69, 103501 (2004), arXiv:astro- ph/0310723. 14

    arXiv 2004

  8. [6]

    The 2dF Galaxy Redshift Survey: power-spectrum analysis of the final dataset and cosmological implica- tions,

    S. Cole et al., “The 2dF Galaxy Redshift Survey: power-spectrum analysis of the final dataset and cosmological implica- tions,” Mon. Not. R. Astron. Soc. 362, 505 (2005), arXiv:astro-ph/0501174

    arXiv 2005

Show all 50 references
  1. [7]

    Detection of the Baryon Acoustic Peak in the Large-Scale Correlation Function of SDSS Luminous Red Galaxies,

    D. J. Eisenstein et al., “Detection of the Baryon Acoustic Peak in the Large-Scale Correlation Function of SDSS Luminous Red Galaxies,” Astrophys. J. 633, 560 (2005), arXiv:astro-ph/0501171

    2005 arXiv

  2. [8]

    The cosmological constant problem,

    S. Weinberg, “The cosmological constant problem,”Rev. Mod. Phys. 61, 1 (1989)

    1989

  3. [9]

    Everything You Always Wanted To Know About The Cosmological Constant Problem (But Were Afraid To Ask),

    J. Martin, “Everything You Always Wanted To Know About The Cosmological Constant Problem (But Were Afraid To Ask),” Comptes Rendus Physique 13, 566 (2012), arXiv:1205.3365 [astro-ph.CO]

    2012 arXiv

  4. [10]

    ADarkEnergyModelCharacterizedbytheAgeoftheUniverse,

    R.G.Cai, “ADarkEnergyModelCharacterizedbytheAgeoftheUniverse,” Phys. Lett. B 657, 228(2007), arXiv:0707.4049 [hep-th]

    2007 arXiv

  5. [11]

    Gravitation and quantum mechanics of macroscopic objects,

    F. Karolyhazy, “Gravitation and quantum mechanics of macroscopic objects,”Il Nuovo Cimento A 42, 390 (1966)

    1966

  6. [12]

    Space-time in light of Karolyhazy uncertainty relation,

    M. Maziashvili, “Space-time in light of Karolyhazy uncertainty relation,”Int. J. Mod. Phys. D 16, 1531 (2007), arXiv:gr- qc/0612110

    2007

  7. [13]

    Quantum fluctuations of spacetime and the dark energy problem,

    M. Maziashvili, “Quantum fluctuations of spacetime and the dark energy problem,” Phys. Lett. B 652, 165 (2007), arXiv:0705.0924 [gr-qc]

    2007 arXiv

  8. [14]

    A New Model of Agegraphic Dark Energy,

    H. Wei and R. G. Cai, “A New Model of Agegraphic Dark Energy,”Phys. Lett. B 660, 113 (2008), arXiv:0708.0884 [astro-ph]

    2008 arXiv

  9. [15]

    Interacting Agegraphic Dark Energy,

    H. Wei and R. G. Cai, “Interacting Agegraphic Dark Energy,”Eur. Phys. J. C 59, 99 (2009), arXiv:0707.4052 [hep-th]

    2009 arXiv

  10. [16]

    Interacting New Agegraphic Dark Energy in Brans-Dicke Theory,

    A. Sheykhi, “Interacting New Agegraphic Dark Energy in Brans-Dicke Theory,” Phys. Lett. B 681, 205 (2009), arXiv:0907.5458 [hep-th]

    2009 arXiv

  11. [17]

    New agegraphic dark energy in Brans-Dicke theory,

    K. Karami and A. Abdolmaleki, “New agegraphic dark energy in Brans-Dicke theory,”Phys. Scr., 81, 055901 (2010)

    2010

  12. [19]

    Reconstructing modified gravity models from the entropy-corrected agegraphic dark energy,

    K. Karami et al., “Reconstructing modified gravity models from the entropy-corrected agegraphic dark energy,”Phys. Lett. B, 686, 216 (2010)

    2010

  13. [20]

    Dark energy and dark matter as curvature effects,

    S. Capozziello, V. F. Cardone, and A. Troisi, “Dark energy and dark matter as curvature effects,”JCAP 0608, 001 (2006), arXiv:astro-ph/0602349

    2006 arXiv

  14. [21]

    Modified f(R) gravity consistent with realistic cosmology: From matter dominated epoch to dark energy universe,

    S. Nojiri and S. D. Odintsov, “Modified f(R) gravity consistent with realistic cosmology: From matter dominated epoch to dark energy universe,”Phys. Rev. D 74, 086005 (2006), arXiv:hep-th/0608008

    2006 arXiv

  15. [22]

    f (R) theories of gravity,

    T. P. Sotiriou and V. Faraoni, “f (R) theories of gravity,”Rev. Mod. Phys. 82, 451 (2010), arXiv:0805.1726 [gr-qc]

    2010 arXiv

  16. [23]

    Coincident General Relativity,

    J. B. Jiménez, L. Heisenberg, and T. Koivisto, “Coincident General Relativity,” Phys. Rev. D 98, 044048 (2018), arXiv:1710.03116 [gr-qc]

    2018 arXiv

  17. [24]

    Cosmography in f(Q) gravity,

    S. Mandal, P. K. Sahoo, and J. R. L. Santos, “Cosmography in f(Q) gravity,” Phys. Rev. D 102, 024057 (2020), arXiv:2001.02357 [gr-qc]

    2020 arXiv

  18. [25]

    On the LCDM Universe in f(R) gravity,

    P. K. S. Dunsby, E. Elizalde, R. Goswami, S. Odintsov, and D. S. Gomez, “On the LCDM Universe in f(R) gravity,”Phys. Rev. D 82, 023519 (2010), arXiv:1005.2205 [gr-qc]

    2010 arXiv

  19. [26]

    Dynamics of f (G) cosmology,

    N. Goheer, R. Goswami, and P. K. S. Dunsby, “Dynamics of f (G) cosmology,” Phys. Rev. D 79, 121301 (2009), arXiv:0904.2559 [gr-qc]

    2009 arXiv

  20. [27]

    Reconstruction off (τ, T) gravity in different cosmological models,

    E. H. Baffou, M. J. S. Houndjo, and J. Tossa, “Reconstruction off (τ, T) gravity in different cosmological models,”Eur. Phys. J. C 77, 708 (2017), arXiv:1706.08842 [gr-qc]

    2017 arXiv

  21. [29]

    Nojiri and S.D

    S. Nojiri and S.D. Odintsov, Introduction to modified gravity and gravitational alternative for dark energy, Int. J. Geom. Meth. Mod. Phys. 4 (2007) 115

    2007

  22. [30]

    P., & Anderson, D

    Burnham, K. P., & Anderson, D. R. (2004). Multimodel inference: Understanding AIC and BIC in model selection. Sociological Methods & Research, 33(2), 261–304. https://doi.org/10.1177/0049124104268644

    2004 doi

  23. [31]

    Liddle, A. R. (2004). How many cosmological parameters?Monthly Notices of the Royal Astronomical Society , 351(3), L49–L53. astro-ph/0401198

    2004 arXiv

  24. [32]

    Schwarz, G. (1978). Estimating the dimension of a model. The Annals of Statistics , 6(2), 461–464. https://doi.org/10.1214/aos/1176344136

    1978

  25. [33]

    G., et al

    Adame, A. G., et al. (2024). DESI 2024 VI: Cosmological Constraints from the Measurements of Baryon Acoustic Oscilla- tions. arXiv. https://arxiv.org/abs/2404.03002

    2024 arXiv

  26. [34]

    Gaztanaga, E., Cabre, A., & Hui, L. (2009). Clustering of Luminous Red Galaxies IV: Baryon Acoustic Peak in the Line- of-Sight Direction and a Direct Measurement of H(z).Monthly Notices of the Royal Astronomical Society , 399, 1663–1680. arXiv:0807.3551

    2009 arXiv

  27. [35]

    Oka, A., Saito, S., Nishimichi, T., Taruya, A., & Yamamoto, K. (2014). Simultaneous constraints on the growth of structure and cosmic expansion from the multipole power spectra of the SDSS DR7 LRG sample.Monthly Notices of the Royal Astronomical Society, 439, 2515–2530. arXiv:...

    2014 arXiv

  28. [36]

    Wang, Y., et al. (2017). The clustering of galaxies in the completed SDSS-III Baryon Oscillation Spectroscopic Survey: tomographic BAO analysis of DR12 combined sample in configuration space.Monthly Notices of the Royal Astronomical Society, 469(3), 3762–3774. arXiv:1607.03154

    2017 arXiv

  29. [37]

    Chuang, C.-H., & Wang, Y. (2013). Modeling the Anisotropic Two-Point Galaxy Correlation Function on Small Scales and Improved Measurements of H(z), DA(z), andβ(z) from the Sloan Digital Sky Survey DR7 Luminous Red Galaxies. Monthly Notices of the Royal Astronomical Society , 4...

    2013 arXiv

  30. [38]

    Anderson, L., et al. (2014). The clustering of galaxies in the SDSS-III Baryon Oscillation Spectroscopic Survey: baryon acoustic oscillations in the Data Releases 10 and 11 Galaxy samples.Monthly Notices of the Royal Astronomical Society , 441(1), 24–62. arXiv:1312.4877

    2014 arXiv

  31. [39]

    Zhao, G.-B., et al. (2019). The clustering of the SDSS-IV extended Baryon Oscillation Spectroscopic Survey DR14 quasar sample: a tomographic measurement of cosmic structure growth and expansion rate based on optimal redshift weights. Monthly Notices of the Royal Astronomical S...

    2019 arXiv

  32. [40]

    G., et al

    Busca, N. G., et al. (2013). Baryon Acoustic Oscillations in the Ly-α forest of BOSS quasars.Astronomy & Astrophysics, 552, A96. arXiv:1211.2616

    2013 arXiv

  33. [41]

    Font-Ribera, A., et al. (2014). Quasar-Lymanα Forest Cross-Correlation from BOSS DR11: Baryon Acoustic Oscillations. Journal of Cosmology and Astroparticle Physics , 2014(05), 027. arXiv:1311.1767

    2014 arXiv

  34. [42]

    du Mas des Bourboux, H., et al. (2017). Baryon acoustic oscillations from the complete SDSS-III Lyα-quasar cross- correlation function at z = 2.4.Astronomy & Astrophysics, 608, A130. arXiv:1708.02225

    2017 arXiv

  35. [43]

    Alam, S., et al. (2017). The clustering of galaxies in the completed SDSS-III Baryon Oscillation Spectroscopic Survey: cosmological analysis of the DR12 galaxy sample.Monthly Notices of the Royal Astronomical Society , 470(3), 2617–2652. arXiv:1607.03155

    2017 arXiv

  36. [44]

    Chuang, C.-H., et al. (2013). The clustering of galaxies in the SDSS-III Baryon Oscillation Spectroscopic Survey: single- probe measurements and the strong power of normalized growth rate on constraining dark energy.Monthly Notices of the Royal Astronomical Society, 433, 3559....

    2013 arXiv

  37. [45]

    Blake, C., et al. (2012). The WiggleZ Dark Energy Survey: Joint measurements of the expansion and growth history at z <1. Monthly Notices of the Royal Astronomical Society , 425, 405–414. arXiv:1204.3674

    2012 arXiv

  38. [46]

    Neveux, R., et al. (2020). The completed SDSS-IV extended Baryon Oscillation Spectroscopic Survey: BAO and RSD measurements from the anisotropic power spectrum of the quasar sample between redshift 0.8 and 2.2.Monthly Notices of the Royal Astronomical Society , 499(1), 210–229...

    2020

  39. [47]

    Astronomy & Astrophysics, 641, A6

    PlanckCollaboration, Aghanim, N., Akrami, Y., etal.(2020).Planck2018results.VI.Cosmologicalparameters. Astronomy & Astrophysics, 641, A6. arXiv:1807.06209

    2020 arXiv

  40. [48]

    Verde, L., Treu, T., & Riess, A. G. (2019). Tensions between the early and late Universe.Nature Astronomy, 3, 891–895. arXiv:1907.10625

    2019 arXiv

  41. [49]

    Farooq, O., & Ratra, B. (2013). Hubble parameter measurement constraints on the cosmological deceleration–acceleration transition redshift. The Astrophysical Journal Letters , 766(1), L7. arXiv:1301.5243

    2013 arXiv

  42. [50]

    Zheng, W., Li, H., Xia, J.-Q., Wan, Y.-P., Li, S.-Y., & Li, M. (2014). Constraints on cosmological models from Hubble parameters measurements. International Journal of Modern Physics D , 23(05), 1450051. https://doi.org/10.1142/s0218271814500515

    2014 doi

Pith tools

Reviewed August 6, 2026 · model on record in the stance chip above.