Pith. sign in

REVIEW 3 major objections 2 minor 37 references

Waveguide to Meaning: Semantic-Aware NOMA for Pinching-Antenna Systems

T0 review · 3 major / 2 minor · reviewed 2026-05-10 · grok-4.3

Pith's one-line read Semantic-aware NOMA in pinching-antenna systems yields higher semantic spectral efficiency than fixed-antenna baselines while meeting bit-user QoS.

desk verdict The paper gives a concrete joint optimization for pinching-antenna positions and semantic NOMA power allocation that shows semantic SE gains over fixed antennas, but the results depend on tight assumptions about spacing and decoding order that are not fully stress-tested in the reported experiments. read the letter →

arxiv 2604.05464 v1 submitted 2026-04-07 eess.SP

classification eess.SP
keywords pinching-antennasystemssemanticcommunicationnon-orthogonalmultipleaccessspectralefficiencywaveguidepowerallocationbit-userQoS
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper explores single-waveguide and multi-waveguide pinching-antenna systems combined with semantic communication under NOMA, subject to bit-user quality-of-service constraints and bit-to-semantic decoding order in heterogeneous downlink scenarios. It develops alternating optimization for power allocation and antenna placement in the single-waveguide case, and monotonic optimization with minorization-maximization for the multi-waveguide power subproblem. Numerical results indicate that this setup achieves better semantic spectral efficiency than conventional fixed-antenna systems without violating the bit-user requirements, with the multi-waveguide configuration proving advantageous under stricter QoS or wider coverage demands. A reader would care because the approach points to a practical way to trade conventional bit-rate metrics for semantic utility while preserving baseline service levels.

What carries the argument

The alternating-optimization procedure for single-waveguide power and position variables, together with the monotonic-optimization plus minorization-maximization surrogate for multi-waveguide power allocation, applied to semantic-aware NOMA over waveguides with minimum adjacent spacing.

What would settle it

A simulation or measurement run in which the optimized semantic spectral efficiency falls at or below the fixed-antenna baseline under identical bit-user QoS targets and the same decoding-order constraint.

Watch

Extended reading notes

Core claim

In pinching-antenna systems for semantic communication under NOMA, joint optimization of user power coefficients and pinching-antenna positions produces higher semantic spectral efficiency than fixed-antenna references while satisfying bit-user QoS and maintaining feasible bit-to-semantic decoding order; the multi-waveguide variant further improves channel adjustability when bit-user QoS is high or coverage is wide.

Load-bearing premise

Pinching antennas can be placed exactly at the minimum spacing that prevents mutual coupling and the bit-to-semantic decoding order remains feasible for heterogeneous users.

Editorial extensions

If this is right

  • Semantic spectral efficiency rises while bit-user QoS stays satisfied in both single- and multi-waveguide deployments.
  • Multi-waveguide configurations become preferable when bit-user QoS requirements tighten or coverage area increases.
  • Wireless channels gain adjustability through waveguide and pinching-antenna placement under NOMA and semantic decoding constraints.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • The same placement and power framework could be tested for robustness when user semantic requirements vary continuously rather than in fixed heterogeneous classes.
  • Replacing the current lower-bound surrogate with a tighter convex relaxation might accelerate convergence in larger multi-waveguide arrays.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

3 major / 2 minor

Summary. The manuscript proposes semantic-aware NOMA for pinching-antenna systems (PASS) in single-waveguide and multi-waveguide downlink scenarios. It formulates optimization problems to maximize semantic spectral efficiency subject to bit-user QoS and bit-to-semantic decoding-order constraints, solving the single-waveguide case via alternating optimization of power coefficients and antenna positions (with antennas fixed at minimum adjacent spacing) and the multi-waveguide case via monotonic optimization combined with minorization-maximization. Numerical results are presented claiming superiority over a conventional fixed-antenna baseline.

Significance. If the results hold under verified assumptions, the work would contribute to the intersection of semantic communication, NOMA, and emerging reconfigurable antenna technologies by demonstrating potential SE gains while respecting heterogeneous QoS. The explicit incorporation of decoding-order constraints and the use of monotonic optimization to guarantee non-decreasing objective sequences are positive technical elements.

major comments (3)
  1. [§III.A] §III.A (single-waveguide scenario): The channel model and subsequent SE calculations rest on the assumption that pinching antennas are placed at the exact minimum adjacent spacing that prevents mutual coupling, yet no electromagnetic simulation, reference, or sensitivity analysis is provided to confirm that coupling remains negligible at this spacing; violation would invalidate the effective channel gains used throughout the optimization and numerical comparison.
  2. [Numerical results] Numerical results section (performance figures): The reported semantic-SE gains versus the fixed-antenna baseline lack any description of the underlying channel models, number of Monte-Carlo realizations, random seeds, or error bars, rendering it impossible to assess whether the observed advantage is statistically reliable or sensitive to the unverified spacing and decoding-order assumptions.
  3. [§III.B] §III.B and feasibility constraints: The bit-to-semantic decoding order is imposed as a hard constraint without deriving or verifying the channel conditions under which this order remains feasible for heterogeneous users; if the semantic user’s effective channel is not sufficiently stronger, SIC fails and the entire SE expression used in the objective no longer applies.
minor comments (2)
  1. Notation for semantic versus bit spectral efficiency is introduced without an explicit equation linking the two quantities to the standard Shannon formula under NOMA.
  2. The multi-waveguide lateral-distance assumption is stated but never quantified with a minimum separation value or reference to array-factor calculations.

Simulated Author's Rebuttal

3 responses · 0 unresolved

We thank the referee for the constructive and detailed comments. We address each major comment point by point below, indicating the revisions we will incorporate to improve the manuscript's rigor and clarity.

read point-by-point responses
  1. Referee: [§III.A] §III.A (single-waveguide scenario): The channel model and subsequent SE calculations rest on the assumption that pinching antennas are placed at the exact minimum adjacent spacing that prevents mutual coupling, yet no electromagnetic simulation, reference, or sensitivity analysis is provided to confirm that coupling remains negligible at this spacing; violation would invalidate the effective channel gains used throughout the optimization and numerical comparison.

    Authors: We agree that explicit justification strengthens the channel model. In the revised manuscript, we will cite established electromagnetic analyses and prior PASS literature establishing the minimum adjacent spacing (typically half-wavelength) for negligible mutual coupling in waveguide-based systems. We will also add a sensitivity analysis in the numerical section showing that small spacing perturbations yield negligible changes to effective channel gains and semantic SE, thereby validating the assumptions used in the optimization. revision: yes

  2. Referee: [Numerical results] Numerical results section (performance figures): The reported semantic-SE gains versus the fixed-antenna baseline lack any description of the underlying channel models, number of Monte-Carlo realizations, random seeds, or error bars, rendering it impossible to assess whether the observed advantage is statistically reliable or sensitive to the unverified spacing and decoding-order assumptions.

    Authors: We concur that additional simulation details are necessary for reproducibility and statistical assessment. The revised numerical results section will specify the channel models (including path-loss exponents and Rician fading parameters), confirm the use of 10,000 Monte-Carlo realizations, note random seed settings for reproducibility, and include error bars (standard deviation) on all performance curves to demonstrate that the semantic-SE gains are statistically reliable and robust to the modeling assumptions. revision: yes

  3. Referee: [§III.B] §III.B and feasibility constraints: The bit-to-semantic decoding order is imposed as a hard constraint without deriving or verifying the channel conditions under which this order remains feasible for heterogeneous users; if the semantic user’s effective channel is not sufficiently stronger, SIC fails and the entire SE expression used in the objective no longer applies.

    Authors: The optimization of pinching-antenna positions is designed to ensure the semantic user's effective channel is sufficiently stronger than the bit users', consistent with the imposed decoding order. To address the concern rigorously, the revised manuscript will include a derivation of the minimum effective channel gain ratio required for feasible SIC under the bit-to-semantic order, along with verification in the numerical results by explicitly reporting the realized channel gains for each user and confirming the order holds across the simulated configurations. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity: standard optimization and numerical comparison to baseline

full rationale

The paper formulates standard optimization problems (AO for single-waveguide power and positions; monotonic/MM for multi-waveguide) and reports numerical SE gains versus a fixed-antenna baseline under explicit assumptions on spacing and decoding order. No equation or result reduces to its inputs by construction, no fitted parameter is relabeled as a prediction, and no load-bearing step relies on a self-citation chain. The derivation chain is self-contained against the external baseline comparison.

Assumptions & free parameters 0 free parameters · 0 assumptions · 0 invented entities

Abstract-only review supplies no explicit free parameters, axioms, or invented entities; all modeling assumptions remain implicit.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Waveguide to Meaning: Semantic-Aware NOMA for Pinching-Antenna Systems." pith.science (2026). https://pith.science/paper/2604.05464

@misc{pith2026260405464,
  author       = {Pith},
  title        = {Pith review of: Waveguide to Meaning: Semantic-Aware NOMA for Pinching-Antenna Systems},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/2604.05464}},
  note         = {Machine review of arXiv:2604.05464}
}
read the original abstract

We investigate the performance of the pinching-antenna systems (PASS) for semantic communication (SC) in both single-waveguide and multi-waveguide scenarios, under the constraints of bit-user quality of service (QoS) and bit-to-semantic decoding order in a heterogeneous users downlink non-orthogonal multiple access (NOMA). Multiple pinching antennas in the single-waveguide scenario are at a minimum adjacent spacing required to prevent mutual coupling. An alternating optimization (AO)-based algorithm optimizes users power allocation coefficients and position of pinching antennas in the single-waveguide NOMA framework. For the multi-waveguide scenario, assuming adjacent waveguides at a sufficient lateral distance apart, the waveguides power allocation subproblem is solved using monotonic optimization and minorization-maximization (MM) approach. Specifically, a lower bound surrogate is iteratively maximized under the feasibility constraints such that a non-decreasing sequence of objective is obtained. Numerical results demonstrate that the NOMA based PASS exploiting SC offers higher semantic spectral efficiency (SE) while fulfilling the bit-user QoS requirement when compared to the considered conventional fixed antenna system. Notably, the multi-waveguide scenario becomes more beneficial for creating adjustable wireless channels in stringentconditions with higher bit-user QoS and wider coverage area requirements.

Figures

Figures reproduced from arXiv: 2604.05464 by the authors.

Figure 1
Figure 1. An illustration of single-waveguide PASS serving [PITH_FULL_IMAGE:figures/full_fig_p003_1.png] view at source ↗
Figure 2
Figure 2. Geometry of the multi-waveguide PASS. where k = 1, ..., Kwg and x˜ P k is the longitudinal position on waveguide for stacking into the optimization variable x¯ = [˜x P 1 , . . . , x˜ P Kwg ]. Geometry of the proposed downlink multi-waveguide heterogeneous users setup is illustrated in [PITH_FULL_IMAGE:figures/full_fig_p006_2.png] view at source ↗
Figure 3
Figure 3. Average semantic SE versus Pmax for the NOMA assisted single-waveguide PASS and CAS. Furthermore, a smaller coverage area offers better seman￾tic SE due to shorter links, while the PASS continuously holds advantage over CAS in all deployment areas. In all cases, the semantic power fraction αS is selected on the boundary defined by the QoS constraint, and pinching locations satisfy the minimum spacing criteria, turni… view at source ↗
Figures from the paper (5 more)
Figure 5
Figure 5. Figure 5: compares the schemes of pinching antennas placement with and without phase fine-tuning along the waveguide. In the former, the N pinching antennas are further adjusted along the waveguide to improve phase 0 5 10 15 20 25 30 0.04 0.06 0.08 0.1 0.12 0.14 0.16 0.18 0.2 Av…
Figure 6
Figure 6. Figure 6: Outage probability of the bit-user QoS and SIC [PITH_FULL_IMAGE:figures/full_fig_p009_6.png]
Figure 8
Figure 8. Figure 8: shows average semantic SE versus Pmax for the multi-waveguide PASS, each serving heterogeneous users via NOMA. Consistent with the observations in [PITH_FULL_IMAGE:figures/full_fig_p009_8.png]
Figure 10
Figure 10. Figure 10: compares the fixed and optimal pinching locations for the multi-waveguide scenario by plotting the average semantic SE versus Pmax for both types. For the fixed locations configuration, we position a single pinching antenna at the centre of each waveguide in the multi…
Figure 11
Figure 11. Figure 11: Average semantic SE versus users distance ratio [PITH_FULL_IMAGE:figures/full_fig_p010_11.png]

Discussion (0). Continue with ORCID to comment.

Lean theorems connected to this paper

Citations machine-checked in the Pith Canon. Every link opens the source theorem in the public Lean library.

What do these tags mean?
matches
The paper's claim is directly supported by a theorem in the formal canon.
supports
The theorem supports part of the paper's argument, but the paper may add assumptions or extra steps.
extends
The paper goes beyond the formal theorem; the theorem is a base layer rather than the whole result.
uses
The paper appears to rely on the theorem as machinery.
contradicts
The paper's claim conflicts with a theorem or certificate in the canon.
unclear
Pith found a possible connection, but the passage is too broad, indirect, or ambiguous to say the theorem truly supports the claim.

Reference graph

Works this paper leans on

37 extracted references · 37 canonical work pages

  1. [1]

    Adaptive resource allocation for semantic communication networks,

    L. Wang, W. Wu, F. Zhou, Z. Yang, Z. Qin, and Q. Wu, “Adaptive resource allocation for semantic communication networks,” IEEE Trans. Commun., vol. 72, no. 11, pp. 6900– 6916, 2024

  2. [2]

    Millimeter wave MIMO with lens antenna array: A new path division multiplexing paradigm,

    Y. Zeng and R. Zhang, “Millimeter wave MIMO with lens antenna array: A new path division multiplexing paradigm,” IEEE Trans. Commun., vol. 64, no. 4, pp. 1557–1571, 2016

  3. [3]

    MIMO capacity characteri- zation for movable antenna systems,

    W. Ma, L. Zhu, and R. Zhang, “MIMO capacity characteri- zation for movable antenna systems,” IEEE Trans. Wireless Commun., vol. 23, no. 4, pp. 3392–3407, 2023

  4. [4]

    The roadmap to 6G: AI empowered wireless networks,

    K. B. Letaief, W. Chen, Y. Shi, J. Zhang, and Y.-J. A. Zhang, “The roadmap to 6G: AI empowered wireless networks,” IEEE Commun. Mag., vol. 57, no. 8, pp. 84–90, 2019

  5. [5]

    Flexible-antenna systems: A pinching-antenna perspective,

    Z. Ding, R. Schober, and H. V. Poor, “Flexible-antenna systems: A pinching-antenna perspective,” IEEE Trans. Com- mun., vol. 73, no. 10, pp. 9236–9253, 2025

  6. [6]

    Pinching antennas: Principles, applications and challenges,

    Z. Yang, N. Wang, Y. Sun, Z. Ding, R. Schober, G. K. Karagiannidis, V. W. Wong, and O. A. Dobre, “Pinching antennas: Principles, applications and challenges,” arXiv preprint arXiv:2501.10753, 2025

  7. [7]

    Pinching-antenna systems: Architecture designs, opportuni- ties, and outlook,

    Y. Liu, Z. Wang, X. Mu, C. Ouyang, X. Xu, and Z. Ding, “Pinching-antenna systems: Architecture designs, opportuni- ties, and outlook,” IEEE Commun. Mag., vol. 64, no. 1, pp. 190–196, 2025

  8. [8]

    Sum- rate maximization for pinching antenna-assisted NOMA syst ems with multiple dielectric waveguides,

    S. Hu, R. Zhao, Y. Liao, D. W. K. Ng, and J. Yuan, “Sum- rate maximization for pinching antenna-assisted NOMA sys- tems with multiple dielectric waveguides,” arXiv preprint arXiv:2503.10060, 2025

Show all 37 references
  1. [9]

    Power minimization for NOMA-assisted pinching antenna systems with multiple waveguides,

    Y. Fu, F. He, Z. Shi, and H. Zhang, “Power minimization for NOMA-assisted pinching antenna systems with multiple waveguides,” arXiv preprint arXiv:2503.20336, 2025

  2. [10]

    Channel estimation for pinching-antenna systems (PASS),

    J. Xiao, J. Wang, and Y. Liu, “Channel estimation for pinching-antenna systems (PASS),” IEEE Commun. Lett., 2025

  3. [11]

    Joint trans- mit and pinching beamforming for pinching antenna system (PASS): Optimization-based or learning-based?

    X. Xu, X. Mu, Y. Liu, and A. Nallanathan, “Joint trans- mit and pinching beamforming for pinching antenna system (PASS): Optimization-based or learning-based?” IEEE Trans. Wireless Commun., vol. 25, pp. 11 449–11 464, 2026

  4. [12]

    Performance analysis of pinching-antenna systems,

    D. Tyrovolas, S. A. Tegos, P. D. Diamantoulakis, S. Ioanni- dis, C. K. Liaskos, and G. K. Karagiannidis, “Performance analysis of pinching-antenna systems,” IEEE Trans. Cogn. Commun. Netw., vol. 12, pp. 590–601, 2025

  5. [13]

    Sum-rate maximiza- tion for NOMA-assisted pinching-antenna systems,

    Z. Zhou, Z. Yang, G. Chen, and Z. Ding, “Sum-rate maximiza- tion for NOMA-assisted pinching-antenna systems,” IEEE Wireless Commun. Lett., vol. 14, no. 9, pp. 2728–2732, 2025

  6. [14]

    Antenna activation for NOMA assisted pinching-antenna systems,

    K. Wang, Z. Ding, and R. Schober, “Antenna activation for NOMA assisted pinching-antenna systems,” IEEE Wireless Commun. Lett., vol. 14, no. 5, pp. 1526–1530, 2025

  7. [15]

    Antenna acti- vation and resource allocation in multi-waveguide pinching- antenna systems,

    K. Wang, Z. Ding, and G. K. Karagiannidis, “Antenna acti- vation and resource allocation in multi-waveguide pinching- antenna systems,” IEEE Trans. Wireless Commun., vol. 25, pp. 4070–4082, 2025

  8. [16]

    Analytical optimization for an- tenna placement in pinching-antenna systems,

    Z. Ding and H. V. Poor, “Analytical optimization for an- tenna placement in pinching-antenna systems,” arXiv preprint arXiv:2507.13307, 2025

  9. [17]

    Exploiting pinching- antenna systems in multicast communications,

    S. Shan, C. Ouyang, Y. Li, and Y. Liu, “Exploiting pinching- antenna systems in multicast communications,” IEEE Trans. Commun., vol. 74, pp. 419–432, 2026

  10. [18]

    A gradient meta-learning joint optimization for beamforming and antenna position in pinching-antenna systems,

    K. Zhou, W. Zhou, D. Cai, X. Lei, Y. Xu, Z. Ding, and P. Fan, “A gradient meta-learning joint optimization for beamforming and antenna position in pinching-antenna systems,” arXiv preprint arXiv:2506.12583, 2025

  11. [19]

    C. E. Shannon and W. Weaver, The Mathematical Theory of Communication. Champaign, IL, USA: Univ. Illinois Press, 1949

  12. [20]

    Beyond transmitting bits: Context, semantics, and task-oriented communications,

    D. Gündüz, Z. Qin, I. E. Aguerri, H. S. Dhillon, Z. Yang, A. Yener, K. K. Wong, and C.-B. Chae, “Beyond transmitting bits: Context, semantics, and task-oriented communications,” IEEE J. Sel. Areas Commun., vol. 41, no. 1, pp. 5–41, Jan. 2023

  13. [21]

    Semantic com- munications for future internet: Fundamentals, applications, and challenges,

    W. Yang, H. Du, Z. Q. Liew, W. Y. B. Lim, Z. Xiong, D. Niyato, X. Chi, X. Shen, and C. Miao, “Semantic com- munications for future internet: Fundamentals, applications, and challenges,” IEEE Commun. Surveys Tuts., vol. 25, no. 1, pp. 213–250, 2022

  14. [22]

    Semantic- preserved communication system for highly efficient speech transmission,

    T. Han, Q. Yang, Z. Shi, S. He, and Z. Zhang, “Semantic- preserved communication system for highly efficient speech transmission,” IEEE J. Sel. Areas Commun., vol. 41, no. 1, pp. 245–259, Jan. 2023

  15. [23]

    Semantic communications in 6G: Coexistence, multiple access, and satellite networks,

    I. Ahmed, Y. Sun, J. Fu, A. Köse, L. Musavian, M. Xiao, and B. Özbek, “Semantic communications in 6G: Coexistence, multiple access, and satellite networks,” IEEE Commun. Stand. Mag., 2025

  16. [24]

    Resource allocation for text semantic communications,

    L. Yan, Z. Qin, R. Zhang, Y. Li, and G. Y. Li, “Resource allocation for text semantic communications,” IEEE Wireless Commun. Lett., vol. 11, no. 7, pp. 1394–1398, 2022

  17. [25]

    Uplink NOMA semantic communications: Semantic reconstruction for SIC,

    B. Chen, X. Wang, D. Li, R. Jiang, and Y. Xu, “Uplink NOMA semantic communications: Semantic reconstruction for SIC,” in IEEE/CIC Int. Conf. Commun. China (ICCC), Dalian, China, August 10–12, 2023, pp. 1–6

  18. [26]

    Deep learning en- abled semantic communication systems,

    H. Xie, Z. Qin, G. Y. Li, and B.-H. Juang, “Deep learning en- abled semantic communication systems,” IEEE Trans. Signal Process., vol. 69, pp. 2663–2675, 2021

  19. [27]

    Semantic com- munication: A survey on research landscape, challenges, and future directions,

    T. M. Getu, G. Kaddoum, and M. Bennis, “Semantic com- munication: A survey on research landscape, challenges, and future directions,” Proceedings of the IEEE, vol. 112, no. 11, pp. 1649–1685, 2024

  20. [28]

    BERT: Pre-training of deep bidirectional transformers for language understanding,

    J. Devlin, “BERT: Pre-training of deep bidirectional transformers for language understanding,” arXiv preprint arXiv:1810.04805, 2018

  21. [29]

    Exploiting semantic communication for non-orthogonal multiple access,

    X. Mu and Y. Liu, “Exploiting semantic communication for non-orthogonal multiple access,” IEEE J. Sel. Areas Commun., vol. 41, no. 8, pp. 2563–2576, 2023

  22. [30]

    Multi-user semantic communication on hybrid 12 NOMA,

    Z. Meng, L. Huang, Q. Li, W. Zhang, B. Tang, C. Wang, and X. Ge, “Multi-user semantic communication on hybrid 12 NOMA,” in Proc. 28th Asia–Pacific Conf. Commun. (APCC), Sydney, NSW, Australia, Nov. 2023, pp. 136–142

  23. [31]

    Hybrid NOMA assisted het- erogeneous semantic and bit users communication,

    I. Ahmed and L. Musavian, “Hybrid NOMA assisted het- erogeneous semantic and bit users communication,” arXiv preprint arXiv:2505.03379, 2025

  24. [32]

    Beam focusing for near-field multiuser MIMO communications,

    H. Zhang, N. Shlezinger, F. Guidi, D. Dardari, M. F. Imani, and Y. C. Eldar, “Beam focusing for near-field multiuser MIMO communications,” IEEE Trans. Wireless Commun., vol. 21, no. 9, pp. 7476–7490, 2022

  25. [33]

    Heterogeneous semantic and bit communications: A semi-NOMA scheme,

    X. Mu, Y. Liu, L. Guo, and N. Al-Dhahir, “Heterogeneous semantic and bit communications: A semi-NOMA scheme,” IEEE J. Sel. Areas Commun., vol. 41, no. 1, pp. 155–169, 2022

  26. [34]

    Dual methods for nonconvex spectrum optimization of multicarrier systems,

    W. Yu and R. Lui, “Dual methods for nonconvex spectrum optimization of multicarrier systems,” IEEE Trans. Commun., vol. 54, no. 7, pp. 1310–1322, 2006

  27. [35]

    Monotonic optimiza- tion in communication and networking systems,

    Y. J. A. Zhang, L. Qian, and J. Huang, “Monotonic optimiza- tion in communication and networking systems,” Foundations and Trends® in Networking, vol. 7, no. 1, pp. 1–75, 2013

  28. [36]

    Majorization- minimization algorithms in signal processing, communica- tions, and machine learning,

    Y. Sun, P. Babu, and D. P. Palomar, “Majorization- minimization algorithms in signal processing, communica- tions, and machine learning,” IEEE Trans. Signal Process., vol. 65, no. 3, pp. 794–816, 2016

  29. [37]

    An introduction to majorization-minimization algorithms for machine learning and statistical estimation,

    H. D. Nguyen, “An introduction to majorization-minimization algorithms for machine learning and statistical estimation,” Wiley Interdisciplinary Rev.: Data Mining Knowl. Discovery, vol. 7, no. 2, pp. 1–12, 2017

Pith tools

Reviewed May 10, 2026 · model on record in the stance chip above.