Pith. sign in

REVIEW 7 minor 126 references

Probing Quantum Geometric Phases via Scanning Tunneling Microscopy

T0 review · 0 major / 7 minor · reviewed 2026-07-12 · grok-4.5

Pith's one-line read Scanning tunneling microscopy can map quantum geometric phases in real space, turning them into local observables that constrain topology and correlated order.

desk verdict Solid, accurate review of four STM routes to real-space geometric phases; organizational value only, no new data or methods. read the letter →

arxiv 2606.29564 v2 pith:Z55YVRIT submitted 2026-06-28 cond-mat.mes-hall cond-mat.supr-con

classification cond-mat.mes-hallcond-mat.supr-con
keywords scanningtunnelingmicroscopyBerryphaseAharonov-Bohmeffectchargedensitywavepairmagic-anglegraphenewavefrontdislocations2Dlock-in
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

Quantum geometric phases shape the topology and many-body behavior of electrons, but bulk probes usually average them away. This review shows that scanning tunneling microscopy and spectroscopy resolve those phases locally by converting them into measurable real-space patterns. Four complementary routes are surveyed: nanoscale interferometers that read out the Aharonov-Bohm phase from magnetic-field oscillations of the local density of states; defect scattering that produces wavefront dislocations whose number equals the Berry phase of graphene; order-parameter decomposition that reconstructs the complex phase structure of intervalley-coherent states in magic-angle graphene; and numerical 2D lock-in filtering that maps the phase textures and topological defects of pair-density and charge-density waves in unconventional superconductors. Taken together, the methods turn abstract geometric phases into atomic-scale maps that can diagnose topological states, symmetry breaking, and strong correlations, and that open a path to engineering those phases in situ.

What carries the argument

Four STM-based phase-to-observable maps: (1) real-space Aharonov-Bohm interferometers formed by scatterers or artificial quantum dots; (2) counting extra wavefronts in intervalley Friedel oscillations to read the Berry phase; (3) symmetry-adapted Fourier decomposition of complex order parameters; (4) numerical 2D lock-in extraction of amplitude and phase of density-wave modulations.

What would settle it

In a well-characterized density-wave or graphene defect system, change the lock-in window size, cutoff, or target wave-vector by amounts comparable to experimental resolution and check whether the reported phase windings and dislocation counts remain invariant; if they flip or appear only for particular filter choices, the extracted phases are not physical.

Watch

Extended reading notes

Core claim

Phase-resolved STM imaging translates quantum geometric phases into real-space, locally resolvable observables. Across four methodologies—Aharonov-Bohm interferometry, wavefront-dislocation analysis of Berry phase, order-parameter decomposition in moiré systems, and 2D lock-in mapping of density-wave phases—the paper argues that STM thereby supplies stringent constraints on topological order, symmetry-breaking patterns, and electronic correlations, forming a practical framework for in-situ phase engineering.

Load-bearing premise

The numerical filters used to pull phase maps out of STM images (especially the 2D lock-in step) faithfully recover the physical phase textures and do not invent defects when the signal is near the noise floor.

Editorial extensions

If this is right

  • Atomic-scale phase maps become a routine diagnostic that can discriminate among competing topological and correlated ground states that look identical to bulk probes.
  • Defects and tip fields can be used deliberately as local phase manipulators, enabling in-situ engineering of vortices, dislocations, and intervalley order.
  • The same real-space phase tools extend to transition-metal dichalcogenides, kagome lattices, and other multivalley or spin-orbit systems that host geometric phases.
  • Time-resolved and Josephson STM variants can track transient phase dynamics and superconducting phase slips that are invisible to static spectroscopy.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Because the phase maps are post-processed, independent groups re-analyzing the same raw STM datasets with open filter codes will be needed before the method is accepted as a standard diagnostic.
  • Combining spin-polarized STM with the proposed quantum-metric extraction could turn the geometric tensor itself into a routinely mappable quantity rather than a derived transport property.
  • If tip-induced electric or magnetic fields can controllably write and erase phase vortices, the same platform becomes a testbed for topological information processing at the single-defect level.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

0 major / 7 minor

Summary. This review surveys four STM/STS methodologies for resolving quantum geometric phases in real space: (i) nanoscale interferometry of the Aharonov-Bohm phase via closed electron trajectories and magnetic-flux-dependent LDOS oscillations; (ii) extraction of the Berry phase from defect-induced intervalley quasiparticle interference and wavefront dislocations in graphene and related systems; (iii) reconstruction of complex order-parameter phases (e.g., intervalley coherent and Kekulé orders) in magic-angle twisted bilayer graphene and hydrogen-adatom graphene via Fourier filtering and C3v-adapted decomposition; and (iv) mapping of PDW/CDW phase textures and topological defects in cuprates, iron-based films, and NbSe2 with the numerical 2D lock-in technique. The manuscript synthesizes primary experimental and theoretical literature, presents the standard equations for AB phase accumulation, wavefront counting, order-parameter components, and lock-in demodulation, and concludes that phase-resolved STM supplies local constraints on topology, symmetry breaking, and correlations while enabling in-situ phase engineering.

Significance. If the synthesis holds, the paper supplies a timely, coherent map of how atomic-scale tunneling spectroscopies convert geometric and many-body phases into real-space observables. The four-paradigm organization is pedagogically useful for mesoscopic and correlated-electron communities, and the explicit Discussion caveats on filter sensitivity strengthen rather than weaken the review. Strengths include accurate restatement of primary results (AB interferometry on graphene quantum dots, wavefront dislocations confirming π Berry phase, IVC/Kekulé phase vortices, and PDW–CDW phase relations), standard equations without ad-hoc parameters, and a forward-looking outlook on time-resolved and tip-engineered phase control. As a review it does not claim new experiments or derivations, but it organizes an emerging toolkit that is already shaping interpretation of topological and PDW states.

minor comments (7)
  1. Introduction and §I: the AB phase difference is written both as 2πΦ/Φ0 and later as Δϕ = (e/h)∮A·dl = (e/h)ΦB; a single consistent convention (and explicit statement that the factor of 2 arises from the two counter-propagating paths) would help non-specialist readers.
  2. §II and Fig. 2: the transition from two wavefront dislocations (symmetric defect) to one (asymmetric defect) is clear, but a brief sentence linking the observed dislocation number to the winding of the pseudospin texture (rather than only to angular momentum 2) would tighten the Berry-phase identification.
  3. §III: the six complex order parameters adapted to C3v are introduced without an explicit listing or reference equation; a short table or parenthetical definition of the three IVC channels (bond, site A, site B) would improve reproducibility of the decomposition.
  4. §IV, lock-in formulae: the real-space Gaussian cutoff σr and reciprocal-space cutoff σq appear without recommended ranges or a note on how they are chosen relative to the moiré or CDW period; a practical remark would reduce the risk of over-filtering.
  5. Figures 1–4 captions are informative but dense; labeling the key wave vectors (QIVC, QPDW, 2Q) directly on the panels would aid rapid reading.
  6. A few typographical inconsistencies remain (e.g., “mod ern”, “conducti ng”, “s pace”, “demonstrat ed”, “superconducti vity”); a final copy-edit pass is warranted.
  7. References include several preprints and overlapping-author works; ensuring that primary experimental claims are always paired with the original experimental citation (in addition to any theory follow-ups) would further clarify provenance.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: this is a methods review that synthesizes independent primary experiments and theories without deriving new predictions from its own inputs or self-referential definitions.

full rationale

The manuscript is an explicit review of four established STM methodologies (AB interferometry, wavefront-dislocation Berry-phase extraction, order-parameter decomposition, and 2D lock-in PDW/CDW phase mapping). It contains no original derivation chain, no fitted parameters that are later re-labeled as predictions, no uniqueness theorems imported from the authors’ prior work to force a conclusion, and no ansatz smuggled in as a first-principles result. All equations (e.g., the AB phase 2πΦ/Φ0, the PDW order-parameter form Δ(r)=Δ_Q e^{iQ·r}+Δ_{-Q}e^{-iQ·r}, and the 2D lock-in filter expressions) are standard textbook or previously published constructions that are merely restated for exposition. Self-citations (e.g., Yin et al. on kagome Chern magnets) appear only as illustrative examples of systems to which the reviewed techniques could be extended; they are not load-bearing for any claim. The Discussion section itself flags the numerical sensitivity of 2D lock-in filtering, confirming that the authors do not treat post-processed phase maps as raw observables. Consequently the paper’s synthesis claim—that phase-resolved STM supplies real-space constraints on topology and correlations—rests entirely on the cited external literature and is free of circular reduction.

Assumptions & free parameters 0 free parameters · 3 assumptions · 0 invented entities

As a review the paper inherits the standard assumptions of STM theory (Tersoff-Hamann LDOS interpretation, elastic tunneling) and of the four cited experimental programs. No free parameters are fitted, no new entities are postulated, and the domain assumptions are those already accepted in the primary literature it surveys.

assumptions (3)
  • domain assumption Differential conductance dI/dV maps the local density of states (Tersoff-Hamann approximation).
    Invoked throughout as the link between measured current and electronic phase information; standard in STM literature since 1985.
  • domain assumption Intervalley scattering in graphene produces a √3×√3 R30° modulation whose wavefront dislocations count pseudospin winding.
    Taken from Dutreix et al. (2019) and related works; used as the foundation for zero-field Berry-phase extraction in Section II.
  • domain assumption The complex amplitude extracted by 2D lock-in filtering of an STM map at wavevector Q yields the physical phase texture of the corresponding density-wave order.
    Central to Section IV; the paper itself notes sensitivity to filter parameters, so the axiom is accepted with the stated caveat.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Probing Quantum Geometric Phases via Scanning Tunneling Microscopy." pith.science (2026). https://pith.science/paper/Z55YVRIT

@misc{pith2026260629564,
  author       = {Pith},
  title        = {Pith review of: Probing Quantum Geometric Phases via Scanning Tunneling Microscopy},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/Z55YVRIT}},
  note         = {Machine review of arXiv:2606.29564}
}
read the original abstract

The quantum geometric phase intrinsically dictates the geometry, topology, and many-body correlations of electronic wave functions. While quantum geometric phases are conventionally inferred through momentum-space probes or macroscopic transport measurements, their direct visualization and quantification in real space have historically been restricted by the spatial averaging of bulk techniques. Scanning tunneling microscopy and spectroscopy (STM/STS) circumvent this limitation, leveraging atomic-scale spatial resolution and high energy sensitivity to resolve local electronic phase profiles directly. This review highlights recent progress across four representative methodologies: probing the Aharonov-Bohm (AB) geometric phase via nanoscale real space interferometry; extracting the Berry phase from defect-induced quasiparticle interference and wavefront dislocations; reconstructing the complex phase structure in symmetric systems, such as magic-angle graphene, using order parameter decomposition; and mapping the phase textures and topological defects of pair density wave (PDW) and charge density wave (CDW) in unconventional superconductors utilizing the numerical 2D lock-in technique. Together, these developments show how quantum phases can be translated onto real space and locally resolvable observables. Phase-resolved STM imaging provides stringent constraints on topological states of matter, symmetry-breaking patterns, and strong electronic correlations, outlining a robust framework for in situ phase engineering in quantum materials.

Figures

Figures reproduced from arXiv: 2606.29564 by the authors.

Figure 1
Figure 1. Probing the AB effect using STM. (a) Schematic illustration of an STM interferometer, in which quantum interference arises from electron-wave scattering by two impurities located at r1 and r2, as reflected in the measured LDOS. Upon applying an external magnetic field, the AB effect modulates the interference process, resulting in periodic oscillations of the LDOS16; (b) Theoretical simulations of the interference p… view at source ↗
Figure 1
Figure 1. Probing the AB effect using STM. (a) Schematic illustration of an STM interferometer, in which quantum interference arises from electron-wave scattering by two impurities located at r1 and r2, as reflected in the measured LDOS. Upon applying an external magnetic field, the AB effect modulates the interference process, resulting in periodic oscillations of the LDOS16; (b) Theoretical simulations of the interference p… view at source ↗
Figure 2
Figure 2. Probing quantum phase via backscattering and wavefront dislocation [PITH_FULL_IMAGE:figures/full_fig_p014_2.png] view at source ↗
Figures from the paper (5 more)
Figure 2
Figure 2. Figure 2: Probing quantum phase via backscattering and wavefront dislocation [PITH_FULL_IMAGE:figures/full_fig_p013_2.png]
Figure 3
Figure 3. Figure 3: Probing phase information via order-parameter decomposition. (a) Schematic illustration of decomposing a local order parameter based on FFT. The order parameter can be further resolved into three intervalley coherent components, whose amplitudes are combined along mutu…
Figure 3
Figure 3. Figure 3: Probing phase information via order-parameter decomposition. (a) Schematic illustration of decomposing a local order parameter based on FFT. The order parameter can be further resolved into three intervalley coherent components, whose amplitudes are combined along mutu…
Figure 4
Figure 4. Figure 4: Probing the phase of PDW and CDW using the 2D lock-in technique. (a) Schematic illustration of a half-vortex in a PDW100; (b) Corresponding phase map for panel (a)100; (c) Schematic illustration of a dislocation in a CDW100; (d) Corresponding phase map for panel (c)100…
Figure 4
Figure 4. Figure 4: Probing the phase of PDW and CDW using the 2D lock-in technique. (a) Schematic illustration of a half-vortex in a PDW100; (b) Corresponding phase map for panel (a)100; (c) Schematic illustration of a dislocation in a CDW100; (d) Corresponding phase map for panel (c)100…

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

126 extracted references · 5 linked inside Pith

  1. [1]

    & Weibel, E

    Binnig, G., Rohrer, H., Gerber, Ch. & Weibel, E. Surface Studies by Scanning Tunneling Microscopy. Phys. Rev. Lett. 49, 57-61 (1982)

  2. [2]

    & Hamann, D

    Tersoff, J. & Hamann, D. R. Theory of the scanning tunneling microscope. Phys. Rev. B 31, 805- 813 (1985)

  3. [3]

    & Rohrer, H

    Binnig, G. & Rohrer, H. Scanning tunneling microscopy -from birth to adolescence. Rev. Mod. Phys. 59, 615-625 (1987)

  4. [4]

    & Bohm, D

    Aharonov, Y . & Bohm, D. Significance of Electromagnetic Potentials in the Quantum Theory. Phys. Rev. 115, 485-491 (1959)

  5. [5]

    Tonomura, A. et al. Observation of Aharonov-Bohm Effect by Electron Holography. Phys. Rev. Lett. 48, 1443-1446 (1982)

  6. [6]

    J., Wind, S

    Chandrasekhar, V ., Rooks, M. J., Wind, S. & Prober, D. E. Observation of Aharonov -Bohm Electron Interference Effects with Periods h/e and h/2e in Individual Micron-Size, Normal-Metal Rings. Phys. Rev. Lett. 55, 1610-1613 (1985)

  7. [7]

    & Laibowitz, R

    Webb, R., Washburn, S., Umbach, C. & Laibowitz, R. Observation of h/e Aharonov-Bohm Oscillations in Normal-Metal Rings. Phys. Rev. Lett 54, 2696-2699 (1985)

  8. [8]

    & Webb, R

    Washburn, S., Schmid, H., Kern, D. & Webb, R. A. Normal -metal Aharonov-Bohm effect in the presence of a transverse electric field. Phys. Rev. Lett. 59, 1791 (1987)

Show all 126 references
  1. [9]

    H., Nazarov, Y

    van Oudenaarden, A., Devoret, M. H., Nazarov, Y . V . & Mooij, J. E. Magneto-electric Aharonov- Bohm effect in metal rings. Nature 391, 768-770 (1998)

  2. [10]

    Hackens, B. et al. Imaging and controlling electron transport inside a quantum ring. Nature Phys 2, 826-830 (2006)

  3. [11]

    Peng, H. et al. Aharonov-Bohm interference in topological insulator nanoribbons. Nature Mater 9, 225-229 (2010)

  4. [12]

    Cho, S. et al. Aharonov-Bohm oscillations in a quasi -ballistic three -dimensional topological insulator nanowire. Nat Commun 6, 7634 (2015)

  5. [13]

    Xu, S. G. et al. Giant oscillations in a triangular network of one -dimensional states in marginally twisted graphene. Nat Commun 10, 4008 (2019)

  6. [14]

    Ronen, Y . et al. Aharonov-Bohm effect in graphene -based Fabry -Pérot quantum Hall interferometers. Nat. Nanotechnol. 16, 563-569 (2021)

  7. [15]

    Guo, C. et al. Many-body interference in kagome crystals. Nature 647, 68-73 (2025)

  8. [16]

    & Paul, I

    Cano, A. & Paul, I. Aharonov -Bohm oscillations in the local density of states. Phys. Rev. B 80, 153401 (2009)

  9. [17]

    de Juan, F., Cortijo, A., V ozmediano, M. A. H. & Cano, A. Aharonov -Bohm interferences from local deformations in graphene. Nature Phys 7, 810-815 (2011)

  10. [18]

    Fu, Z.-G., Zhang, P. & Li, S. -S. Aharonov-Bohm oscillations in the local density of topological surface states. Appl. Phys. Lett. 99, 243110 (2011)

  11. [19]

    -G., Zhang, P

    Fu, Z. -G., Zhang, P. & Li, S. -S. Probing crossover from analogous weak antilocalization to localization by an Aharonov -Bohm interferometer on topological insulator surface. Appl. Phys. Lett. 100, 133103 (2012)

  12. [20]

    Ge, Z. et al. Giant orbital magnetic moments and paramagnetic shift in artificial relativistic atoms and molecules. Nat. Nanotechnol. 18, 250-256 (2023)

  13. [21]

    Yoffe, A. D. Low -dimensional systems: quantum size effects and electronic properties of semiconductor microcrystallites (zero -dimensional systems) and some quasi -two-dimensional systems. Advances in Physics 42, 173-262 (1993)

  14. [22]

    Ashoori, R. C. Electrons in artificial atoms. Nature 379, 413-419 (1996)

  15. [23]

    Reimann, S. M. & Manninen, M. Electronic structure of quantum dots. Rev. Mod. Phys. 74, 1283- 1342 (2002). 17

  16. [24]

    Li, S.-Y . & He, L. Recent progresses of quantum confinement in graphene quantum dots. Front. Phys. 17, 33201 (2022)

  17. [25]

    Fu, Z.-Q. et al. Relativistic Artificial Molecules Realized by Two Coupled Graphene Quantum Dots. Nano Lett. 20, 6738-6743 (2020)

  18. [26]

    Zheng, Q. et al. Molecular Collapse States in Graphene/WSe 2 Heterostructure Quantum Dots. Phys. Rev. Lett. 130, 076202 (2023)

  19. [27]

    Zhou, X.-F. et al. Relativistic artificial molecule of two coupled graphene quantum dots at tunable distances. Nat Commun 15, 8786 (2024)

  20. [28]

    Liu, Y .-W., Ren, Y .-N., Hao, C. -Y . & He, L. Direct observation of magneto -electric Aharonov- Bohm effect in moiré -scale quantum paths of minimally twisted bilayer graphene. Preprint at https://doi.org/10.48550/arXiv.2102.00164 (2021)

  21. [29]

    Novoselov, K. S. et al. Two-dimensional gas of massless Dirac fermions in graphene. Nature 438, 197–200 (2005)

  22. [30]

    Zhang, Y ., Tan, Y .-W., Stormer, H. L. & Kim, P. Experimental observation of the quantum Hall effect and Berry’s phase in graphene. Nature 438, 201-204 (2005)

  23. [31]

    H., Guinea, F., Peres, N

    Castro Neto, A. H., Guinea, F., Peres, N. M. R., Novoselov, K. S. & Geim, A. K. The electronic properties of graphene. Rev. Mod. Phys. 81, 109-162 (2009)

  24. [32]

    Novoselov, K. S. et al. Unconventional quantum Hall effect and Berry’s phase of 2 π in bilayer graphene. Nature Phys 2, 177-180 (2006)

  25. [33]

    F., Zhang, Y

    Young, A. F., Zhang, Y . & Kim, P. Experimental Manifestation of Berry Phase in Graphene. in Physics of Graphene (eds Aoki, H. & S. Dresselhaus, M.) 3-27 (Springer International Publishing, Cham, 2014)

  26. [34]

    Ghahari, F. et al. An on/off Berry phase switch in circular graphene resonators. Science 356, 845- 849 (2017)

  27. [35]

    Pan, W. et al. Berry phase and anomalous transport of the composite fermions at the half -filled Landau level. Nature Phys 13, 1168-1172 (2017)

  28. [36]

    Hou, Z., Zhou, Y .-F., Xie, X. C. & Sun, Q.-F. Berry phase induced valley level crossing in bilayer graphene quantum dots. Phys. Rev. B 99, 125422 (2019)

  29. [37]

    Liu, Y .-W., Hou, Z., Li, S.-Y ., Sun, Q.-F. & He, L. Movable Valley Switch Driven by Berry Phase in Bilayer-Graphene Resonators. Phys. Rev. Lett. 124, 166801 (2020)

  30. [38]

    Ren, Y .-N., Cheng, Q., Sun, Q.-F. & He, L. Realizing Valley-Polarized Energy Spectra in Bilayer Graphene Quantum Dots via Continuously Tunable Berry Phases. Phys. Rev. Lett. 128, 206805 (2022)

  31. [39]

    Rutter, G. M. et al. Scattering and Interference in Epitaxial Graphene. Science 317, 219-222 (2007)

  32. [40]

    Brihuega, I. et al. Quasiparticle Chirality in Epitaxial Graphene Probed at the Nanometer Scale. Phys. Rev. Lett. 101, 206802 (2008)

  33. [41]

    Mallet, P. et al. Role of pseudospin in quasiparticle interferences in epitaxial graphene probed by high-resolution scanning tunneling microscopy. Phys. Rev. B 86, 045444 (2012)

  34. [42]

    Nye, J. F. & Berry, M. V . Dislocations in wave trains. Proc. A 336, 165-190 (1974)

  35. [43]

    Dutreix, C. et al. Measuring the Berry phase of graphene from wavefront dislocations in Friedel oscillations. Nature 574, 219-222 (2019)

  36. [44]

    Liu, Y .-W. et al. Visualizing a single wavefront dislocation induced by orbital angular momentum in graphene. Nat Commun 15, 3546 (2024)

  37. [45]

    Zhang, Y ., Su, Y . & He, L. Quantum Interferences of Pseudospin-Mediated Atomic-Scale V ortices in Monolayer Graphene. Nano Lett. 21, 2526-2531 (2021)

  38. [46]

    Zhang, M. -H. et al. Atomic-level precision creation and manipulation of interfacial Se chemisorbates in graphene/WSe2 heterostructures. Phys. Rev. B 110, L041405 (2024)

  39. [47]

    & Yang, W

    Zhang, S.-H., Yang, J., Shao, D.-F., Wu, Z. & Yang, W. Robust wavefront dislocations of Friedel oscillations in gapped graphene. Phys. Rev. B 103, L161407 (2021). 18

  40. [48]

    & Chang, K

    Zhang, S.-H., Yang, J., Shao, D.-F., Yang, W. & Chang, K. Geometric wavefront dislocations of RKKY interaction in graphene. Phys. Rev. B 104, 245405 (2021)

  41. [49]

    & Yang, W

    Yang, J., Zhang, S.-H. & Yang, W. Wavefronts Dislocations of Friedel Oscillations in Graphene: Trigonal Warping Effect. physica status solidi (RRL) - Rapid Research Letters 18, 2300378 (2024)

  42. [50]

    & Marzari, N

    Park, C.-H. & Marzari, N. Berry phase and pseudospin winding number in bilayer graphene. Phys. Rev. B 84, 205440 (2011)

  43. [51]

    Yin, L.-J., Li, S.-Y ., Qiao, J.-B., Nie, J.-C. & He, L. Landau quantization in graphene monolayer, Bernal bilayer, and Bernal trilayer on graphite surface. Phys. Rev. B 91, 115405 (2015)

  44. [52]

    Yin, L.-J., Jiang, H., Qiao, J. -B. & He, L. Direct imaging of topological edge states at a bilayer graphene domain wall. Nat Commun 7, 11760 (2016)

  45. [53]

    Yang, G., Li, L., Lee, W. B. & Ng, M. C. Structure of graphene and its disorders: a review. Science and Technology of Advanced Materials 19, 613-648 (2018)

  46. [54]

    Yan, C., Zhao, Y .-X., Liu, Y .-W. & He, L. Kinetics of Nanobubbles in Tiny-Angle Twisted Bilayer Graphene. Nano Lett. 23, 8532-8538 (2023)

  47. [55]

    Zhang, Y ., Su, Y . & He, L. Local Berry Phase Signatures of Bilayer Graphene in Intervalley Quantum Interference. Phys. Rev. Lett. 125, 116804 (2020)

  48. [56]

    Cao, Y . et al. Correlated insulator behaviour at half-filling in magic-angle graphene superlattices. Nature 556, 80-84 (2018)

  49. [57]

    Cao, Y . et al. Unconventional superconductivity in magic-angle graphene superlattices. Nature 556, 43-50 (2018)

  50. [58]

    Yankowitz, M. et al. Tuning superconductivity in twisted bilayer graphene. Science 363, 1059- 1064 (2019)

  51. [59]

    Lu, X. et al. Superconductors, orbital magnets and correlated states in magic -angle bilayer graphene. Nature 574, 653-657 (2019)

  52. [60]

    Sharpe, A. L. et al. Emergent ferromagnetism near three -quarters filling in twisted bilayer graphene. Science 365, 605-608 (2019)

  53. [61]

    Kerelsky, A. et al. Maximized electron interactions at the magic angle in twisted bilayer graphene. Nature 572, 95-100 (2019)

  54. [62]

    Choi, Y . et al. Electronic correlations in twisted bilayer graphene near the magic angle. Nat. Phys. 15, 1174-1180 (2019)

  55. [63]

    Xie, Y . et al. Spectroscopic signatures of many -body correlations in magic -angle twisted bilayer graphene. Nature 572, 101-105 (2019)

  56. [64]

    Jiang, Y . et al. Charge order and broken rotational symmetry in magic -angle twisted bilayer graphene. Nature 573, 91-95 (2019)

  57. [65]

    Wong, D. et al. Cascade of electronic transitions in magic-angle twisted bilayer graphene. Nature 582, 198-202 (2020)

  58. [66]

    N., Zhang, Y ., Liu, Y

    Ren, Y . N., Zhang, Y ., Liu, Y . W. & He, L. Twistronics in graphene-based van der Waals structures. Chin. Phys. B 29, 117303 (2020)

  59. [67]

    Andrei, E. Y . et al. The marvels of moiré materials. Nat Rev Mater 6, 201-206 (2021)

  60. [68]

    Oh, M. et al. Evidence for unconventional superconductivity in twisted bilayer graphene. Nature 600, 240-245 (2021)

  61. [69]

    Choi, Y . et al. Interaction-driven band flattening and correlated phases in twisted bilayer graphene. Nat. Phys. 17, 1375-1381 (2021)

  62. [70]

    Choi, Y . et al. Correlation-driven topological phases in magic -angle twisted bilayer graphene. Nature 589, 536-541 (2021)

  63. [71]

    Xie, Y . et al. Fractional Chern insulators in magic -angle twisted bilayer graphene. Nature 600, 439-443 (2021)

  64. [72]

    & Dai, X

    Liu, J. & Dai, X. Orbital magnetic states in moiré graphene systems. Nat Rev Phys 3, 367-382 (2021). 19

  65. [73]

    Lin, J. -X. et al. Spin-orbit-driven ferromagnetism at half moiré filling in magic -angle twisted bilayer graphene. Science 375, 437-441 (2022)

  66. [74]

    Nuckolls, K. P. & Y azdani, A. A microscopic perspective on moiré materials. Nat Rev Mater 9, 460-480 (2024)

  67. [75]

    Phong, V . T. & Mele, E. J. Obstruction and Interference in Low-Energy Models for Twisted Bilayer Graphene. Phys. Rev. Lett. 125, 176404 (2020)

  68. [76]

    Gao, A., Nagaosa, N., Ni, N. & Xu, S. -Y . Quantum Geometry Phenomena in Condensed Matter Systems. Preprint at https://doi.org/10.48550/arXiv.2508.00469 (2025)

  69. [77]

    Zhang, S. -H. et al. Geometric Amplitude Accompanying Local Responses: Spinor Phase Information from the Amplitudes of Spin -Polarized STM Measurements. Phys. Rev. Lett. 133, 036204 (2024)

  70. [78]

    Zheng, S.-H. et al. Origin of planar Hall effect on the surface of topological insulators: Tilt of Dirac cone by an in-plane magnetic field. Phys. Rev. B 101, 041408 (2020)

  71. [79]

    Zhang, S.-B. et al. Super-Resonant Transport of Topological Surface States Subjected to In-Plane Magnetic Fields. Phys. Rev. Lett. 127, 076601 (2021)

  72. [80]

    Zhang, S. -H. et al. Spin-polarized STM measurement scheme for quantum geometric tensor. Preprint at https://doi.org/10.48550/arXiv.2501.13588 (2025)

  73. [81]

    & Mesaros, A

    Engström, L., Simon, P. & Mesaros, A. Detecting the topological winding of superconducting nodes via local density of states. Phys. Rev. B 111, 134505 (2025)

  74. [82]

    Bawden, L. et al. Spin-valley locking in the normal state of a transition -metal dichalcogenide superconductor. Nat Commun 7, 11711 (2016)

  75. [83]

    Yin, J.-X. et al. Quantum-limit Chern topological magnetism in TbMn 6Sn6. Nature 583, 533-536 (2020)

  76. [84]

    Xu, X. et al. Topological charge -entropy scaling in kagome Chern magnet TbMn 6Sn6. Nat Commun 13, 1197 (2022)

  77. [85]

    Călugăru, D. et al. Spectroscopy of Twisted Bilayer Graphene Correlated Insulators. Phys. Rev. Lett. 129, 117602 (2022)

  78. [86]

    & Vafek, O

    Kang, J. & Vafek, O. Strong Coupling Phases of Partially Filled Twisted Bilayer Graphene Narrow Bands. Phys. Rev. Lett. 122, 246401 (2019)

  79. [87]

    Bultinck, N. et al. Ground State and Hidden Symmetry of Magic-Angle Graphene at Even Integer Filling. Phys. Rev. X 10, 031034 (2020)

  80. [88]

    Lian, B. et al. Twisted bilayer graphene. IV . Exact insulator ground states and phase diagram. Phys. Rev. B 103, 205414 (2021)

  81. [89]

    Kwan, Y . H. et al. Kekulé Spiral Order at All Nonzero Integer Fillings in Twisted Bilayer Graphene. Phys. Rev. X 11, 041063 (2021)

  82. [90]

    P., Soejima, T

    Hong, J. P., Soejima, T. & Zaletel, M. P. Detecting Symmetry Breaking in Magic Angle Graphene Using Scanning Tunneling Microscopy. Phys. Rev. Lett. 129, 147001 (2022)

  83. [91]

    Nuckolls, K. P. et al. Quantum textures of the many-body wavefunctions in magic-angle graphene. Nature 620, 525-532 (2023)

  84. [92]

    Guan, Y . et al. Observation of Kekulé vortices around hydrogen adatoms in graphene. Nat Commun 15, 2927 (2024)

  85. [93]

    Yin, J. X. & Wang, Q. H. Superconducting gap modulations: Are they from pair density waves or pair-breaking scattering? Acta Phys. Sin. 73, 157401-3 (2024)

  86. [94]

    Hamidian, M. H. et al. Detection of a Cooper-pair density wave in Bi2Sr2CaCu2O8+x. Nature 532, 343-347 (2016)

  87. [95]

    Ruan, W. et al. Visualization of the periodic modulation of Cooper pairing in a cuprate superconductor. Nature Phys 14, 1178-1182 (2018)

  88. [96]

    Edkins, S. D. et al. Magnetic field -induced pair density wave state in the cuprate vortex halo. Science 364, 976-980 (2019). 20

  89. [97]

    Du, Z. et al. Imaging the energy gap modulations of the cuprate pair -density-wave state. Nature 580, 65-70 (2020)

  90. [98]

    Wang, S. et al. Scattering interference signature of a pair density wave state in the cuprate pseudogap phase. Nat Commun 12, 6087 (2021)

  91. [99]

    Wang, Z. et al. Density wave order with antiphase feature associated with the pseudogap in cuprate superconductor Bi2+xSr2-xCuO6+δ. Preprint at https://doi.org/10.48550/arXiv.2503.24177 (2025)

  92. [100]

    Liu, Y . et al. Pair density wave state in a monolayer high -Tc iron-based superconductor. Nature 618, 934-939 (2023). 101.Wei, T., Liu, Y ., Ren, W., Wang, Z. & Wang, J. Intertwined charge and pair density or d ers in a monolayer high -Tc iron-based superconductor. Preprint a...

  93. [101]

    Zhao, H. et al. Smectic pair-density-wave order in EuRbFe4As4. Nature 618, 940-945 (2023)

  94. [102]

    & Fu, Y .-S

    Zhang, Y ., Yang, L., Liu, C., Zhang, W. & Fu, Y .-S. Visualizing uniform lattice-scale pair density wave in single -layer FeSe/SrTiO3 films. Preprint at https://doi.org/10.48550/arXiv.2406.05693 (2024)

  95. [103]

    Kong, L. et al. Cooper-pair density modulation state in an iron-based superconductor. Nature 640, 55-61 (2025)

  96. [104]

    Wei, T. et al. Observation of Superconducting Pair Density Modulation within Lattice Unit Cell. Chinese Phys. Lett. 42, 027404 (2025)

  97. [105]

    Ding, C. et al. Parity Breaking and Sublattice Dichotomy in Monolayer FeSe Superconductor. Phys. Rev. Lett. 136, 066502 (2026)

  98. [106]

    Chen, H. et al. Roton pair density wave in a strong-coupling kagome superconductor. Nature 599, 222-228 (2021)

  99. [107]

    Jiang, K. et al. Kagome superconductors A V3Sb5 (A = K, Rb, Cs). Natl Sci Rev 10, nwac199 (2023)

  100. [108]

    Deng, H. et al. Chiral kagome superconductivity modulations with residual Fermi arcs. Nature 632, 775-781 (2024)

  101. [109]

    Yan, X.-Y . et al. Chiral Pair Density Waves with Residual Fermi Arcs in RbV3Sb5. Chinese Phys. Lett. 41, 097401 (2024)

  102. [110]

    Han, X. et al. Atomic manipulation of the emergent quasi-2D superconductivity and pair density wave in a kagome metal. Nat. Nanotechnol. 20, 1017-1025 (2025)

  103. [111]

    Di Sante, D. et al. Kagome metals. Rev. Mod. Phys. 98, 015002 (2026)

  104. [112]

    X., Sharma, R

    Liu, X., Chong, Y . X., Sharma, R. & Davis, J. C. S. Discovery of a Cooper-pair density wave state in a transition-metal dichalcogenide. Science 372, 1447-1452 (2021)

  105. [113]

    Cao, L. et al. Directly visualizing nematic superconductivity driven by the pair density wave in NbSe2. Nat Commun 15, 7234 (2024)

  106. [114]

    Wei, L.-X. et al. Unidirectional charge and pair density waves in topological monolayer 1 T′- MoTe2. Phys. Rev. B 112, L060503 (2025)

  107. [115]

    Cheng, F.-J. et al. Imaging Sublattice Cooper-Pair Density Waves in Monolayer 1T′-MoTe2. Phys. Rev. Lett. 135, 166201 (2025)

  108. [116]

    Aishwarya, A. et al. Melting of the charge density wave by generation of pairs of topological defects in UTe2. Nat. Phys. 20, 964-969 (2024)

  109. [117]

    & Kivelson, S

    Berg, E., Fradkin, E. & Kivelson, S. A. Charge-4e superconductivity from pair-density-wave order in certain high-temperature superconductors. Nature Phys 5, 830-833 (2009)

  110. [118]

    Agterberg, D. F. & Tsunetsugu, H. Dislocations and vortices in pair-density-wave superconductors. Nature Phys 4, 639-642 (2008)

  111. [119]

    Chuang, T. -M. et al. Nematic Electronic Structure in the “Parent” State of the Iron -Based Superconductor Ca(Fe1–xCox)2As2. Science 327, 181-184 (2010)

  112. [120]

    Barja, S. et al. Charge density wave order in 1D mirror twin boundaries of single -layer MoSe2. 21 Nature Phys 12, 751-756 (2016)

  113. [121]

    & Gao, C.-L

    Liu, C.-Y ., Zhao, M., Wang, Z. & Gao, C.-L. P-d Correlation-Determined Charge Order Stiffness and Corresponding Quantum Melting in Monolayer 1T-TiSe2. ACS Nano 18, 32858-32867 (2024)

  114. [122]

    & Yao, W

    Xiao, D., Liu, G.-B., Feng, W., Xu, X. & Yao, W. Coupled Spin and Valley Physics in Monolayers of MoS2 and Other Group-VI Dichalcogenides. Phys. Rev. Lett. 108, 196802 (2012)

  115. [123]

    Sipos, B. et al. From Mott state to superconductivity in 1T-TaS2. Nature Mater 7, 960-965 (2008)

  116. [124]

    Li, T. et al. Continuous Mott transition in semiconductor moiré superlattices. Nature 597, 350- 354 (2021)

  117. [125]

    Zeng, Y . et al. Thermodynamic evidence of fractional Chern insulator in moiré MoTe 2. Nature 622, 69-73 (2023)

  118. [126]

    Lu, J. M. et al. Evidence for two -dimensional Ising superconductivity in gated MoS 2. Science 350, 1353-1357 (2015)

Pith tools

Reviewed July 12, 2026 · model on record in the stance chip above.