Pith. sign in

REVIEW 12 cited by

Late time tails of the massive vector field in a black hole background

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv gr-qc/0602047 v2 pith:77DK4RFQ submitted 2006-02-13 gr-qc

classification gr-qc
keywords decayblackfieldlate-timemassiveasymptoticallylatevector
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
abstract

We investigate the late-time behavior of the massive vector field in the background of the Schwarzschild and Schwarzschild-de Sitter black holes. For Schwarzschild black hole, at intermediately late times the massive vector field is represented by three functions with different decay law $\Psi_{0} \sim t^{-(\ell + 3/2)} \sin{m t}$, $\Psi_{1} \sim t^{-(\ell + 5/2)} \sin{m t}$, $\Psi_{2} \sim t^{-(\ell + 1/2)} \sin{m t}$, while at asymptotically late times the decay law $\Psi \sim t^{-5/6} \sin{(m t)}$ is universal, and does not depend on the multipole number $\ell$. Together with previous study of massive scalar and Dirac fields where the same asymptotically late-time decay law was found, it means, that the asymptotically late-time decay law $\sim t^{-5/6} \sin{(m t)}$ \emph{does not depend} also \emph{on the spin} of the field under consideration. For Schwarzschild-de Sitter black holes it is observed two different regimes in the late-time decay of perturbations: non-oscillatory exponential damping for small values of $m$ and oscillatory quasinormal mode decay for high enough $m$. Numerical and analytical results are found for these quasinormal frequencies.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 12 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Hawking emission of massive vector fields by Kerr black holes

    gr-qc 2026-07 conditional novelty 7.0 of 10

    First computation of massive vector (Proca) Hawking emission spectra from Kerr black holes, including polarization-dependent greybody factors, Page functions, and mass-enhanced superradiance up to ~7%.

  2. Quasi-bound states and late-time evolution of a massive fermion around a Reissner-Nordstr\"{o}m black hole

    gr-qc 2026-07 accept novelty 6.0 of 10

    Matrix matching yields improved quasi-bound spectra (fine structure + decay widths) for a massive Dirac field on RN, and branch-cut analysis plus simulations reveal an intermediate oscillatory power law followed by a ...

  3. Two types of quasinormal modes of Casadio-Fabbri-Mazzacurati brane-world black holes

    gr-qc 2026-02 unverdicted novelty 6.0 of 10

    Quasinormal modes of massive scalars in CFM brane-world black holes split into two types, with modes disappearing at critical masses where real or imaginary frequency parts reach zero.

  4. Long-Lived Quasinormal Modes and Quasi-Resonances around Non-Minimal Einstein-Yang-Mills Black Holes

    gr-qc 2025-05 conditional novelty 6.0 of 10

    Massive scalar fields around non-minimal Einstein-Yang-Mills black holes can form arbitrarily long-lived quasi-resonances in flat space, but not in de Sitter space; an analytic large-mass frequency formula is given.

  5. Time Evolution of Black Hole Perturbations in Quadratic Gravity

    gr-qc 2025-05 conditional novelty 6.0 of 10

    Gravitational perturbations of Einstein-Weyl black holes show late-time oscillatory tails decaying as t^{-5/6} and break the null-geodesic correspondence in the eikonal regime.

  6. Non-Minimal Einstein-Yang-Mills Black Holes: Fundamental Quasinormal Mode and Grey-Body factors versus Outburst of Overtones

    gr-qc 2025-04 conditional novelty 6.0 of 10

    For non-minimal Einstein-Yang-Mills black holes, the fundamental quasinormal mode stays Schwarzschild-like but the first overtones deviate sharply, with the ℓ=0 second overtone's real frequency tending to zero as the ...

  7. Learning to Balance Motor Thermal Safety and Quadrupedal Locomotion Performance with Residual Policy

    cs.RO 2026-05 unverdicted novelty 5.0 of 10

    A two-stage RL method adds a residual policy on a thermal model to let a quadruped maintain performance while preventing motor overheating, shown in simulation and on a Unitree A1 carrying 3 kg for over 13 minutes ver...

  8. Gravitational quasinormal modes of the Hayward spacetime

    gr-qc 2025-08 conditional novelty 5.0 of 10

    Gravitational quasinormal modes of the Hayward black hole are computed with WKB and time-domain methods, showing that the quantum parameter gamma raises frequencies, weakens damping, and acts slightly more on the firs...

  9. Gravitational perturbations of a regular T-duality inspired black hole: Quasinormal modes, excitation factors, and time-domain evolution

    gr-qc 2026-07 conditional novelty 4.0 of 10

    Gravitational quasinormal-mode frequencies of a T-duality-inspired regular black hole are computed, showing the zero-point length makes the ringdown oscillate faster and alters damping non-monotonically.

  10. Long-lived quasinormal modes of Asymptotically de Sitter Black Holes in Generalized Proca Theory

    gr-qc 2026-05 unverdicted novelty 4.0 of 10

    Massive scalar perturbations of de Sitter black holes in generalized Proca theory enter a large-mass regime with linearly growing real frequencies and constant damping rates, without true quasi-resonances, plus an ana...

  11. Telling tails and quasi-resonances in the vicinity of Dymnikova regular black hole

    gr-qc 2026-01 unverdicted novelty 4.0 of 10

    Massive scalar perturbations on the Dymnikova regular black hole exhibit growing oscillation frequencies, reduced damping rates leading to quasi-resonances, power-law oscillatory tails, and mass-dependent suppression ...

  12. Correspondence between quasinormal modes and grey-body factors for massive fields in Schwarzschild-de Sitter spacetime

    gr-qc 2024-12 conditional novelty 4.0 of 10

    For massive scalar fields around de Sitter black holes, grey-body factors computed from quasinormal modes agree with direct WKB calculations to high precision, even for low multipoles.

Pith tools