Pith. sign in

REVIEW 5 cited by

GLASS: Generator for Large Scale Structure

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2302.01942 v2 pith:J3ORNG4Z submitted 2023-02-03 astro-ph.CO

classification astro-ph.CO
keywords galaxyglasslensingmatterweakfieldsgalaxiesgenerator
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

We present GLASS, the Generator for Large Scale Structure, a new code for the simulation of galaxy surveys for cosmology, which iteratively builds a light cone with matter, galaxies, and weak gravitational lensing signals as a sequence of nested shells. This allows us to create deep and realistic simulations of galaxy surveys at high angular resolution on standard computer hardware and with low resource consumption. GLASS also introduces a new technique to generate transformations of Gaussian random fields (including lognormal) to essentially arbitrary precision, an iterative line-of-sight integration over matter shells to obtain weak lensing fields, and flexible modelling of the galaxies sector. We demonstrate that GLASS readily produces simulated data sets with per cent-level accurate two-point statistics of galaxy clustering and weak lensing, thus enabling simulation-based validation and inference that is limited only by our current knowledge of the input matter and galaxy properties.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 5 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. OpenAlex reports about 26 citations worldwide. Full citation record

  1. Analytical covariances for catalogue-based pseudo-$C_\ell$s

    astro-ph.CO 2026-07 conditional novelty 7.0 of 10

    A new analytic method computes disconnected covariance matrices for catalogue-based pseudo-Cℓ power spectra by smoothing source positions and treating self-pair shot noise exactly.

  2. Comparing explicit likelihood and likelihood-free simulation-based inference for weak lensing cosmic shear

    astro-ph.CO 2026-07 conditional novelty 6.0 of 10

    On Euclid-like Gaussian mocks, likelihood-free inference stays well-calibrated under emulator error and non-Gaussian summaries, while explicit Gaussian-likelihood inference becomes miscalibrated and can disagree with ...

  3. Analyzing Line-of-sight selection biases in galaxy-scale strong lensing with external convergence and shear

    astro-ph.CO 2025-06 conditional novelty 6.0 of 10

    A hybrid simulation method predicts line-of-sight convergence and shear distributions for strong lenses, showing that neglecting them biases inferred Hubble constant values by up to about one percent.

  4. Probing the Baryon Distribution with Fast Radio Bursts

    astro-ph.CO 2026-06 unverdicted novelty 5.0 of 10

    SKA FRB dispersion measures and their cross-correlations with Stage IV shear and clustering can pin down baryonic feedback and improve cosmological constraints by factors of ~2–5 under optimistic detection rates.

  5. Cosmology from Nx2pt Analyses of SKAO Wide-Area Surveys

    astro-ph.CO 2026-07 conditional novelty 4.0 of 10

    SKA-Mid AA4 N×2pt combinations of continuum and HI surveys are forecast to deliver ~1% precision on ΛCDM parameters and useful constraints on w0–wa, Mν and Ωk.

Pith tools