pith. sign in

arxiv: hep-ph/9406288 · v1 · pith:UQJICHQGnew · submitted 1994-06-11 · ✦ hep-ph · astro-ph

Standard Model CP-violation and Baryon asymmetry Part I: Zero Temperature

classification ✦ hep-ph astro-ph
keywords phaseswallasymmetriescp-evenfermionfirstgeneralmodel
0
0 comments X
read the original abstract

We consider quantum effects in a world with two coexisting symmetry phases, unbroken and spontaneously broken, as a result of a first order phase transition. The discrete symmetries of the problem are discussed in general. We compute the exact two-point Green function for a free fermion, when a thin wall separates the two phases. The Dirac propagator displays both massive and massless poles, and new CP-even phases resulting from the fermion reflection on the wall. We discuss the possible quark-antiquark CP asymmetries produced in the Standard Model(SM) for the academic $T=0$ case. General arguments indicate that an effect first appears at order $\alpha_W$ in the reflection amplitude, as the wall acts as a source of momentum and the on-shell one-loop self-energy cannot be renormalized away. The asymmetries stem from the interference of the SM CP-odd couplings and the CP-even phases in the propagator. We perform a toy computation that indicates the type of GIM cancellations of the problem. The behaviour can be expressed in terms of two unitarity triangles.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 4 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Electroweak Baryogenesis from Collapsing Domain Walls

    hep-ph 2026-04 unverdicted novelty 6.0

    Collapsing axion-like domain walls generate the baryon asymmetry by acting as an effective chemical potential through coupling to the electroweak topological term, with the asymmetry produced via sphaleron processes.

  2. Mesogenesis through the Ephemeral Dark Decay of Beauty

    hep-ph 2026-04 unverdicted novelty 6.0

    An ultralight scalar enables temporary dark decays of B mesons in the early universe via muon-induced mass shifts of a dark fermion, allowing mesogenesis while remaining compatible with modern flavor constraints.

  3. Mesogenesis through the Ephemeral Dark Decay of Beauty

    hep-ph 2026-04 unverdicted novelty 6.0

    An ultralight scalar temporarily lowers a dark fermion mass via muon thermal density, opening efficient B meson dark decays for baryon asymmetry generation that later shuts off to match flavor data.

  4. Intrinsic Properties of Large CP Violation in the Complex Two-Higgs-Doublet Model

    hep-ph 2025-12 unverdicted novelty 5.0

    Global scans of complex 2HDM show Type-I models maximize gauge CPV near light-Higgs degeneracy with high eEDM, Type-II suppress gauge CPV but permit large Yukawa CPV and low eEDM via cancellations, plus hidden CPV in ...