Pith. sign in

REVIEW 3 major objections 6 minor 75 references

Phase diagram of Rydberg atoms in a two-leg rectangular ladder

T0 review · 3 major / 6 minor · reviewed 2026-08-11 · deepseek-v4-flash

Pith's one-line read In a two-leg Rydberg ladder, increasing laser detuning first breaks translational symmetry into Z_p^+ bond-order waves, then breaks top-bottom reflection through an Ising transition into Z_2p phases, with two floating phases completing…

desk verdict A credible DMRG phase diagram for the ax=2ay Rydberg ladder with solid Potts/AT/chiral transition analysis, but the floating-phase classification is suggestive rather than proven. read the letter →

arxiv 2412.11201 v1 pith:ZVLDXEDJ submitted 2024-12-15 cond-mat.quant-gas hep-latphysics.atom-phquant-ph

classification cond-mat.quant-gashep-latphysics.atom-phquant-ph
keywords Rydbergladderphasediagramdensitywaveorderbond-orderfloatingchiraltransitionIsingDMRG
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper maps the ground-state phase diagram of a two-leg Rydberg ladder with lattice spacings ax = 2ay using the density matrix renormalization group. Its central claim is that detuning drives a two-step symmetry-breaking sequence: the disordered phase first develops a rung bond-order wave that breaks translational Z_p symmetry while preserving top-bottom reflection, and then a further increase in detuning breaks reflection symmetry through an Ising transition, producing staggered Z_2p density waves. The paper also identifies two distinct floating phases, one carrying quasi-long-range bond order and one carrying quasi-long-range density-difference order, and locates conformal points of the three-state Potts and Ashkin-Teller universality classes on the commensurate lines. A sympathetic reader cares because the result shows how lattice geometry controls which symmetry breaks first in programmable Rydberg arrays, and because it predicts specific critical exponents and Kibble-Zurek signatures that experiments could probe.

What carries the argument

The central objects are the rung bond-order operator B_i = a†_{i,1}a_{i,2} + a†_{i,2}a_{i,1} and the rung density-difference operator m_i = n_{i,2} − n_{i,1}, whose correlations distinguish the Z_p^+ phases from the Z_2p phases and define the two floating phases. The argument is carried by structure factors peaked at the incommensurate wave vector, Binder cumulant data collapse for critical points and exponents, entanglement entropy to locate phase boundaries, and finite-size extrapolation of commensurate lines to locate the CFT points where the chiral transition lines cross them.

What would settle it

Recompute the phase diagram with interactions kept over 30, 40, or 60 consecutive rungs and check whether the Z_3^+ lobe boundary and the claimed CFT point at (Δ/Ω, Rb/a) = (2.7901, 2.3749) move outside the reported error bars, and independently fit the correlation functions C_B(i,r) and C_m(i,r) in the two floating phases at L = 613 to power-law decay; if the fitted exponents are not algebraic or the oscillation amplitudes vanish with system size, the FL and FL+ classification would not hold.

Watch

Extended reading notes

Core claim

The paper establishes that, in the ax = 2ay Rydberg ladder, the crystalline orders accessible from the disordered phase appear in a defined order: intermediate detuning produces Z_p^+ phases in which every pth rung carries a positive bond order, an entangled state of the form (|r,g⟩ + |g,r⟩)/√2 that preserves the top-bottom reflection symmetry; larger detuning then drives an Ising transition that breaks reflection symmetry, doubling the period to Z_2p phases with staggered occupations of the top or bottom leg. Along the commensurate lines with k = 2π/3 and k = π/2, the direct melting of the Z_3^+ and Z_4^+ orders into the disordered phase occurs through a three-state Potts CFT point and an Ashkin-Teller CFT point respectively, flanked by non-CFT chiral transition lines; the correlation-length exponent ν peaks and the dynamical exponent z dips at these CFT points, and the Kibble-Zurek exponent reaches about 0.46 and 0.45 there. Between crystalline orders the paper finds two floating phases: FL+, with quasi-long-range incommensurate bond-order correlations, and FL, with quasi-long-range incommensurate rung density-difference correlations, separated from the disordered phase by BKT transitions and from crystalline order by Pokrovsky-Talapov transitions.

Load-bearing premise

The phase diagram rests on truncating van der Waals interactions to twenty-one consecutive rungs and on classifying the floating phases from Friedel oscillations and structure-factor peak heights in ladders up to 613 rungs, without an explicit demonstration of algebraic decay; if the cutoff shifts the lobe boundaries or CFT points, or if those oscillations are finite-size artifacts, the reported diagram would change.

Editorial extensions

If this is right

  • The two-step ordering sequence gives a concrete prediction: in an ax = 2ay ladder, increasing detuning should first produce a symmetric bond-order wave with period p, and only at higher detuning should the top-bottom reflection symmetry break into a staggered period-2p density wave.
  • The Z_3^+ and Z_4^+ lobes should each host exactly one conformal point, of three-state Potts and Ashkin-Teller type respectively, and the Kibble-Zurek exponent should be maximal at those points, giving an experimentally accessible signature.
  • Two distinct floating phases should intervene between crystalline orders: FL+ adjacent to symmetric Z_p^+ order and FL adjacent to reflection-broken Z_p order, with BKT and Pokrovsky-Talapov transitions on their respective boundaries.
  • The aspect ratio of the ladder is decisive: unlike the ay = 2ax geometry studied in earlier work, the ax = 2ay geometry supports symmetric Z_p^+ orders, so geometry, not just blockade radius, determines which symmetry breaks first.
  • The phases and critical points found here should be realizable in Rydberg tweezer arrays with interactions truncated to twenty-one consecutive rungs, making the predicted exponents and order patterns testable in current quantum simulators.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • If the two-step symmetry-breaking sequence is generic, similar bond-order-first ordering should appear in other quasi-1D arrays with strong intra-rung coupling, such as zigzag or triangular ladders, whenever the intra-rung interaction dominates the inter-rung interaction.
  • The twenty-one-rung interaction cutoff is a natural source of error: extending the range to 30 or more rungs could shift the lobe boundaries and the reported CFT coordinates, so an interaction-range extrapolation would be a direct robustness test.
  • The existence of two floating phases suggests a general rule that each crystalline order melts into a floating phase preserving its short-distance order type, so the number of floating phases should track the number of order-parameter species rather than merely the number of commensurate periods.
  • A concrete experimental probe of the Z_3^+ bond-order wave could use site-resolved readout of the rung correlators after a short evolution, looking for the period-3 oscillation in ⟨B_i⟩ with zero staggered density difference, which would distinguish it from the Z_6 phase without needing Bragg scattering.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 6 minor

Summary. The manuscript uses DMRG to map the ground-state phase diagram of a two-leg Rydberg ladder with lattice spacing ax=2ay, described by a blockade-model Hamiltonian with van der Waals interactions truncated to 21 consecutive rungs. The authors identify Z_p^+ density-wave orders that preserve top-bottom reflection symmetry, Z_{2p} orders that break it, Ising transitions between them, Potts and Ashkin-Teller CFT points on the commensurate lines, chiral transitions away from these points, and two floating phases FL and FL+ characterized by quasi-long-range incommensurate bond-order or density-difference correlations. Critical exponents ν and z are extracted from Binder-cumulant and energy-gap collapses, and the Kibble-Zurek exponent is predicted.

Significance. If the floating-phase classification is confirmed, the paper provides a detailed phase diagram for a two-leg Rydberg ladder with strong interactions and proposes concrete experimental signatures, such as a Kibble-Zurek exponent maximum at the CFT points. The numerical work is carefully described: DMRG truncation errors below 10^-10, explicit sweep convergence criteria, and system sizes up to L=613 are reported. The CFT identifications are supported by consistency of ν with Potts (0.838 vs 5/6) and Ashkin-Teller (0.8076) values and by z close to 1, as well as by the observed maximum of ν at the CFT points. The main weakness is that the quasi-long-range nature of FL and FL+ is not directly demonstrated.

major comments (3)
  1. [Sec. IIIF, Fig. 13, Appendix A] The identification of FL and FL+ as quasi-long-range ordered phases rests on finite-size Friedel-oscillation profiles and structure-factor peak heights at fixed L=289. This evidence does not distinguish algebraic decay from exponential decay with a moderate correlation length; Appendix A explicitly shows that a structure-factor peak can coincide with the oscillation wavevector even for exponentially decaying correlations. The authors do not provide fits of C_m(i,r) or C_B(i,r) to algebraic versus exponential forms, do not show scaling of the peak heights with L, and do not extract a Luttinger parameter or central charge. Because the BKT and PT transition lines surrounding FL/FL+ in Fig. 1(a) are part of the central phase-diagram claim, the QLRO classification must be backed by direct correlation-function scaling or an equivalent finite-size analysis.
  2. [Secs. IIID and IIIE, Figs. 8 and 12] The central claim that the intersections of the Z_3^+ and Z_4^+ boundaries with the commensurate lines are Potts and Ashkin-Teller CFT points rests on the reported exponents, but no error bars or systematic-uncertainty estimates are given for ν, z, or the CFT-point coordinates (2.7901, 2.3749) and (3.3584, 3.4307). The CFT points are obtained from intersections of spline interpolations of seven or ten boundary points and extrapolated constant-k lines, all of which carry finite-size uncertainties. Without a sensitivity analysis (for example, varying the L ranges used in the Binder collapses, bootstrapping over system sizes, or testing the sensitivity to the 1/L correction parameter b in U'_4), the 0.6% discrepancy between ν=0.838 and 5/6 cannot be assessed.
  3. [Secs. IIA and IIF] The Hamiltonian retains van der Waals interactions only within any set of 21 consecutive rungs, and no convergence check with respect to this truncation is provided. Although the 1/r^6 tail beyond 21 rungs is small for the blockade radii studied, the phase boundaries and CFT points are determined by intersections of curves whose locations could shift slightly under a different truncation. A comparison with a longer truncation (for example, 31 rungs) or with the full interaction for at least one representative path in the phase diagram would establish that the reported diagram is not an artifact of this cutoff.
minor comments (6)
  1. [Sec. IIA] The phrase 'within any set of consecutive twenty-one rungs' is ambiguous; please specify whether all pairs with rung-index difference up to 20 are included.
  2. [Fig. 1(a) and Sec. IIIA] The notation Z_p for even p and Z_{2p} for the reflection-broken counterpart of Z_p^+ is potentially confusing because p is used with two meanings; consider a table defining each label and its order parameter.
  3. [Sec. IIID] The statement that z 'continuously increases ... until it reaches the Lifshitz point with z=2' is not supported by data shown in Fig. 8; either add data near the Lifshitz point or soften the claim.
  4. [Sec. IIIF] The sentence 'The prominent heights of the incommensurate peaks indicate the presence of floating phases' should be replaced by a quantitative comparison with disordered-phase peak heights at the same L and normalization, since Appendix A shows that peak position alone is not sufficient.
  5. [Appendix A] The expression for the Fourier transform at η=2 appears to have a typo: the term 4(k-q)^2-4π|k-q|+4π^2/3 should be checked for missing parentheses or factors.
  6. [Sec. IIE] The energy gap ΔE in Eq. (7) is not defined explicitly; please state that it is the difference between the ground state and the first excited state in the DMRG spectrum.

Circularity Check

0 steps flagged · score 1.0 of 10

No significant circularity: the central phase diagram, CFT-point locations, and critical exponents are obtained by independent DMRG measurements rather than by construction.

full rationale

The paper's main derivation chain is self-contained. The CFT points on the Z3+ and Z4+ boundaries are located as intersections of two independently obtained curves: the Zp+ lobe boundary from Binder-cumulant collapses and the commensurate line from finite-size extrapolation of structure-factor peak positions (Secs. IIIB-IIID). The extracted exponents nu and z are then compared with Potts and Ashkin-Teller predictions, so the universality-class identification is not forced by the fitting procedure. The chiral-transition exponents are likewise measured by data collapse rather than assumed. The two floating phases are identified from DMRG profiles, fits to A sin(ki+phi), and incommensurate structure-factor peaks in Sec. IIIF; no equation defines a 'predicted' quantity in terms of the fitted inputs. The self-citations that occur are auxiliary rather than definitional: Ref. [25] is cited for numerical evidence of BKT/PT transitions in floating ladders and for comparison of the ay=2ax diagram, while Ref. [38] is cited for Ising evidence in the lower part of the diagram; the present paper also performs its own Ising collapses (Fig. 4). These uses are minor and do not reduce the central claim to a self-citation chain. The acknowledged limitations - the unresolved narrow FL phase near Z6, the 21-rung interaction cutoff, and the absence of explicit algebraic-decay fits for the floating phases - are evidence-strength concerns, not circular steps, because they do not substitute the conclusion into the input.

Assumptions & free parameters 1 free parameters · 5 assumptions · 0 invented entities

The phase diagram rests on the standard Rydberg Ising-like Hamiltonian, truncated interactions, DMRG convergence, and the assumption that known universality classes apply. The only ad hoc fitting parameter is the 1/L correction b in the Binder cumulant; no new entities are introduced.

free parameters (1)
  • b (1/L correction in U'_4) = not stated
    Introduced in Sec. IIID as U'_4 = U4(1 + b/L) to improve Binder cumulant collapse; b is tuned during fitting and affects the extracted values of (Delta/Omega)_c and nu.
assumptions (5)
  • domain assumption Rydberg Hamiltonian with 1/r^6 van der Waals interactions and blockade (Eq. 1)
    Standard effective model for Rydberg tweezer arrays; stated in Sec. IIA.
  • ad hoc to paper Interactions truncated to 21 consecutive rungs
    Sec. IIA and IIF state 'retaining all Rydberg interactions within any twenty-one consecutive rungs'. This cutoff is load-bearing for boundary locations.
  • domain assumption DMRG converges to the true ground state at truncation error below 1e-10
    Sec. IIF states the convergence criteria; floating phases with long correlation lengths are the most demanding case.
  • standard math Universality classes (Ising, Potts, Ashkin-Teller, chiral, BKT, PT) from the cited literature
    Used to interpret exponents; for example, nu=5/6 for the three-state Potts model and z=1 for CFT points.
  • standard math Validity of Binder cumulant data collapse with subleading 1/L correction
    Eq. (6) and the modified U'_4 follow standard finite-size scaling, but the correction term is not derived in the paper.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Phase diagram of Rydberg atoms in a two-leg rectangular ladder." pith.science (2026). https://pith.science/paper/ZVLDXEDJ

@misc{pith2026241211201,
  author       = {Pith},
  title        = {Pith review of: Phase diagram of Rydberg atoms in a two-leg rectangular ladder},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/ZVLDXEDJ}},
  note         = {Machine review of arXiv:2412.11201}
}
abstract

Using the density matrix renormalization group algorithm, we map the ground-state phase diagram of a two-leg Rydberg ladder array with lattice spacings $a_x=2a_y$. We identify various density wave phases that spontaneously break the translational symmetry or the top-bottom reflection symmetry within the ladder. By increasing the laser detuning from zero, where the system is in a disordered phase that preserves all symmetries, we observe density wave orders with spontaneous breaking of the translational $\mathbb{Z}_p$ symmetries at intermediate detuning values, while the reflection symmetry is preserved. These orders exhibit nonzero bond orders with positive expectation values on every $p$th rung, thus labeled as $\mathbb{Z}_p^+$ phases. At larger detuning values, another spontaneous breaking of the reflection symmetry, which disrupted the bond orders on the rungs, occurs via an Ising phase transition. In these phases, either the top or the bottom site is occupied in a staggered way on every $p$th rung, breaking the translational $\mathbb{Z}_{2p}$ symmetry, thus labeled by $\mathbb{Z}_{2p}$ phases. We locate and characterize the 3-state Potts point and Ashkin-Teller point along the commensurate lines, as well as the direct chiral phase transitions between the disordered phase and the $\mathbb{Z}_p^+$ ($p = 3, 4$) phases. Critical exponents $\nu$ and $z$ are calculated for both conformal and chiral phase transition points. We finally identify two types of floating phases in the phase diagram: one characterized by a quasi-long-range incommensurate bond-order wave, and the other by a quasi-long-range incommensurate wave of density differences in the rungs. Our work motivates further applications of Rydberg atom arrays in quantum simulation.

Figures

Figures reproduced from arXiv: 2412.11201 by the authors.

Figure 1
Figure 1. FIG. 1. (a) The ground-state phase diagram of the two-leg Rydberg ladder with [PITH_FULL_IMAGE:figures/full_fig_p005_1.png] view at source ↗
Figure 2
Figure 2. FIG. 2. (a) The wave vector [PITH_FULL_IMAGE:figures/full_fig_p006_2.png] view at source ↗
Figure 4
Figure 4. FIG. 4. Data collapse of the Binder cumulant for Ising phase [PITH_FULL_IMAGE:figures/full_fig_p007_4.png] view at source ↗
Figures from the paper (7 more)
Figure 5
Figure 5. Figure 5: FIG. 5. Data collapse of the Binder cumulant for quantum phase transitions between the [PITH_FULL_IMAGE:figures/full_fig_p008_5.png]
Figure 6
Figure 6. Figure 6: FIG. 6. The phase boundary of the [PITH_FULL_IMAGE:figures/full_fig_p008_6.png]
Figure 7
Figure 7. Figure 7: FIG. 7. The data collapse of the rescaled energy gap [PITH_FULL_IMAGE:figures/full_fig_p009_7.png]
Figure 9
Figure 9. Figure 9: illustrates the data collapse of the modified [PITH_FULL_IMAGE:figures/full_fig_p009_9.png]
Figure 11
Figure 11. Figure 11: FIG. 11. The same as Fig. 7, but for the CFT point on the [PITH_FULL_IMAGE:figures/full_fig_p010_11.png]
Figure 12
Figure 12. Figure 12: FIG. 12. The same as Fig. 8, but for the [PITH_FULL_IMAGE:figures/full_fig_p010_12.png]
Figure 13
Figure 13. Figure 13: FIG. 13. (a) The profile of the density difference per rung, [PITH_FULL_IMAGE:figures/full_fig_p011_13.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

75 extracted references · 42 canonical work pages

  1. [25]

    Probing quantum floating phases in rydberg atom ar- rays,

    J. Zhang, S. H. Cantú, F. Liu, A. Bylinskii, B. Braver- man, F. Huber, J. Amato-Grill, A. Lukin, N. Gemelke, A. Keesling, S.-T. Wang, Y. Meurice, and S. W. Tsai, “Probing quantum floating phases in rydberg atom ar- rays,” (2024), arXiv:2401.08087 [quant-ph]

  2. [1]

    Labuhn, D

    H. Labuhn, D. Barredo, S. Ravets, S. de Léséleuc, T. Macrì, T. Lahaye, and A. Browaeys, Nature 534, 667 (2016)

  3. [2]

    Bernien, S

    H. Bernien, S. Schwartz, A. Keesling, H. Levine, A. Om- ran, H. Pichler, S. Choi, A. S. Zibrov, M. Endres, M. Greiner, V. Vuletić, and M. D. Lukin, Nature551, 579 (2017)

  4. [3]

    Keesling, A

    A. Keesling, A. Omran, H. Levine, H. Bernien, H. Pich- ler, S. Choi, R. Samajdar, S. Schwartz, P. Silvi, S. Sachdev, P. Zoller, M. Endres, M. Greiner, V. Vuletić, and M. D. Lukin, Nature568, 207 (2019)

  5. [4]

    de Léséleuc, V

    S. de Léséleuc, V. Lienhard, P. Scholl, D. Barredo, S. Weber, N. Lang, H. P. Büchler, T. Lahaye, and A. Browaeys, Science365, 775 (2019)

  6. [5]

    Semeghini, H

    G. Semeghini, H. Levine, A. Keesling, S. Ebadi, T. T. Wang, D. Bluvstein, R. Verresen, H. Pichler, M. Kali- nowski, R. Samajdar, A. Omran, S. Sachdev, A. Vish- wanath, M. Greiner, V. Vuletić, and M. D. Lukin, Sci- ence 374, 1242 (2021)

  7. [6]

    Ebadi, T

    S. Ebadi, T. T. Wang, H. Levine, A. Keesling, G. Se- meghini, A. Omran, D. Bluvstein, R. Samajdar, H. Pich- ler, W. W. Ho, S. Choi, S. Sachdev, M. Greiner, V. Vuletić, and M. D. Lukin, Nature595, 227 (2021)

  8. [7]

    Scholl, M

    P. Scholl, M. Schuler, H. J. Williams, A. A. Eberharter, D. Barredo, K.-N. Schymik, V. Lienhard, L.-P. Henry, T. C. Lang, T. Lahaye, A. M. Läuchli, and A. Browaeys, Nature 595, 233 (2021)

Show all 75 references
  1. [8]

    C. Chen, G. Bornet, M. Bintz, G. Emperauger, L. Leclerc, V. S. Liu, P. Scholl, D. Barredo, J. Hauschild, S. Chatterjee, M. Schuler, A. M. Läuchli, M. P. Zaletel, T. Lahaye, N. Y. Yao, and A. Browaeys, Nature616, 691 (2023)

  2. [9]

    Observation of string breaking on a (2 + 1)d rydberg quantum simulator,

    D. Gonzalez-Cuadra, M. Hamdan, T. V. Zache, B. Braverman, M. Kornjaca, A. Lukin, S. H. Cantu, 14 F. Liu, S.-T. Wang, A. Keesling, M. D. Lukin, P. Zoller, and A. Bylinskii, “Observation of string breaking on a (2 + 1)d rydberg quantum simulator,” (2024), arXiv:2410.16558 [quant-ph]

  3. [10]

    Jaksch, J

    D. Jaksch, J. I. Cirac, P. Zoller, S. L. Rolston, R. Côté, and M. D. Lukin, Phys. Rev. Lett.85, 2208 (2000)

  4. [11]

    M. D. Lukin, M. Fleischhauer, R. Cote, L. M. Duan, D. Jaksch, J. I. Cirac, and P. Zoller, Phys. Rev. Lett. 87, 037901 (2001)

  5. [12]

    Y. O. Dudin, L. Li, F. Bariani, and A. Kuzmich, Nature Physics 8, 790 (2012)

  6. [13]

    Šibalić and C

    N. Šibalić and C. S. Adams,Rydberg Physics, 2399-2891 (IOP Publishing, 2018)

  7. [14]

    Browaeys and T

    A. Browaeys and T. Lahaye, Nature Physics 16, 132 (2020)

  8. [15]

    Chepiga and F

    N. Chepiga and F. Mila, Phys. Rev. Lett.122, 017205 (2019)

  9. [16]

    Chepiga and F

    N. Chepiga and F. Mila, Phys. Rev. Res. 3, 023049 (2021)

  10. [17]

    I. A. Maceira, N. Chepiga, and F. Mila, Phys. Rev. Res. 4, 043102 (2022)

  11. [18]

    Samajdar, W

    R. Samajdar, W. W. Ho, H. Pichler, M. D. Lukin, and S. Sachdev, Phys. Rev. Lett.124, 103601 (2020)

  12. [19]

    Yan, Y.-C

    Z. Yan, Y.-C. Wang, R. Samajdar, S. Sachdev, and Z. Y. Meng, Phys. Rev. Lett.130, 206501 (2023)

  13. [20]

    Samajdar, W

    R. Samajdar, W. W. Ho, H. Pichler, M. D. Lukin, and S. Sachdev, Proceedings of the Na- tional Academy of Sciences 118, e2015785118 (2021), https://www.pnas.org/doi/pdf/10.1073/pnas.2015785118

  14. [21]

    C.-X. Li, S. Yang, and J.-B. Xu, Opt. Lett. 47, 1093 (2022)

  15. [22]

    Chepiga and F

    N. Chepiga and F. Mila, Nature Communications12, 414 (2021)

  16. [23]

    K. Kim, F. Yang, K. Mølmer, and J. Ahn, Phys. Rev. X 14, 011025 (2024)

  17. [24]

    Floating phases in one-dimensional rydberg ising chains,

    M. Rader and A. M. Läuchli, “Floating phases in one-dimensional rydberg ising chains,” (2019), arXiv:1908.02068 [cond-mat.quant-gas]

  18. [26]

    Slagle, Y

    K. Slagle, Y. Liu, D. Aasen, H. Pichler, R. S. K. Mong, X. Chen, M. Endres, and J. Alicea, Phys. Rev. B106, 115122 (2022)

  19. [27]

    Zeybek, R

    Z. Zeybek, R. Mukherjee, and P. Schmelcher, Phys. Rev. Lett. 131, 203003 (2023)

  20. [28]

    Yang and J.-B

    S. Yang and J.-B. Xu, Phys. Rev. E106, 034121 (2022)

  21. [29]

    Samajdar, D

    R. Samajdar, D. G. Joshi, Y. Teng, and S. Sachdev, Phys. Rev. Lett.130, 043601 (2023)

  22. [30]

    Verresen, M

    R. Verresen, M. D. Lukin, and A. Vishwanath, Phys. Rev. X 11, 031005 (2021)

  23. [31]

    Verresen and A

    R. Verresen and A. Vishwanath, Phys. Rev. X12, 041029 (2022)

  24. [32]

    Zhang and Z

    T. Zhang and Z. Cai, Phys. Rev. Lett. 132, 206503 (2024)

  25. [33]

    Kornjača, R

    M. Kornjača, R. Samajdar, T. Macrì, N. Gemelke, S.- T. Wang, and F. Liu, Communications Physics 6, 358 (2023)

  26. [34]

    S. Guo, J. Huang, J. Hu, and Z.-X. Li, Phys. Rev. A 108, 053314 (2023)

  27. [35]

    Tsitsishvili, T

    M. Tsitsishvili, T. Chanda, M. Votto, P. Fromholz, M. Dalmonte, and A. Nersesyan, Phys. Rev. B 105, 155159 (2022)

  28. [36]

    Fromholz, M

    P. Fromholz, M. Tsitsishvili, M. Votto, M. Dalmonte, A. Nersesyan, and T. Chanda, Phys. Rev. B106, 155411 (2022)

  29. [37]

    Sarkar, M

    M. Sarkar, M. Pal, A. Sen, and K. Sengupta, SciPost Phys. 14, 004 (2023)

  30. [38]

    Zhang, S.-W

    J. Zhang, S.-W. Tsai, and Y. Meurice, Phys. Rev. D 110, 034513 (2024)

  31. [39]

    Eck and P

    L. Eck and P. Fendley, Phys. Rev. B108, 125135 (2023)

  32. [40]

    S. R. White, Phys. Rev. Lett.69, 2863 (1992)

  33. [41]

    S. R. White, Phys. Rev. B48, 10345 (1993)

  34. [42]

    D. A. Huse and M. E. Fisher, Phys. Rev. Lett.49, 793 (1982)

  35. [43]

    Eisert, M

    J. Eisert, M. Cramer, and M. B. Plenio, Rev. Mod. Phys. 82, 277 (2010)

  36. [44]

    Affleck and A

    I. Affleck and A. W. W. Ludwig, Phys. Rev. Lett.67, 161 (1991)

  37. [45]

    Holzhey, F

    C. Holzhey, F. Larsen, and F. Wilczek, Nuclear Physics B 424, 443 (1994)

  38. [46]

    Vidal, J

    G. Vidal, J. I. Latorre, E. Rico, and A. Kitaev, Phys. Rev. Lett. 90, 227902 (2003)

  39. [47]

    Calabrese and J

    P. Calabrese and J. Cardy, Journal of Statistical Mechan- ics: Theory and Experiment2004, P06002 (2004)

  40. [48]

    Calabrese and J

    P. Calabrese and J. Cardy, Journal of Physics A: Math- ematical and Theoretical42, 504005 (2009)

  41. [49]

    F. D. M. Haldane, Journal of Physics C: Solid State Physics 14, 2585 (1981)

  42. [50]

    E. Sela, A. Altland, and A. Rosch, Phys. Rev. B 84, 085114 (2011)

  43. [51]

    Laflorencie, E

    N. Laflorencie, E. S. Sørensen, M.-S. Chang, and I. Af- fleck, Phys. Rev. Lett.96, 100603 (2006)

  44. [52]

    Calabrese, M

    P. Calabrese, M. Campostrini, F. Essler, and B. Nien- huis, Phys. Rev. Lett.104, 095701 (2010)

  45. [53]

    J. C. Xavier and F. C. Alcaraz, Phys. Rev. B83, 214425 (2011)

  46. [54]

    Bazavov, Y

    A. Bazavov, Y. Meurice, S.-W. Tsai, J. Unmuth-Yockey, L.-P. Yang, and J. Zhang, Phys. Rev. D 96, 034514 (2017)

  47. [55]

    Unmuth-Yockey, J

    J. Unmuth-Yockey, J. Zhang, P. M. Preiss, L.-P. Yang, S.-W. Tsai, and Y. Meurice, Phys. Rev. A96, 023603 (2017)

  48. [56]

    T. He, J. M. Magan, and S. Vandoren, SciPost Phys.3, 034 (2017)

  49. [57]

    Binder, Journal of Computational Physics 59, 1 (1985)

    K. Binder, Journal of Computational Physics 59, 1 (1985)

  50. [58]

    P. C. Hohenberg and B. I. Halperin, Rev. Mod. Phys.49, 435 (1977)

  51. [59]

    Östlund and S

    S. Östlund and S. Rommer, Phys. Rev. Lett.75, 3537 (1995)

  52. [60]

    Fishman, S

    M. Fishman, S. R. White, and E. M. Stoudenmire, Sci- Post Phys. Codebases , 4 (2022)

  53. [61]

    L. S. Ornstein and F. Zernike, Amsterdam Proc. Sec. Sci. 17, 414 (1914)

  54. [62]

    X.-J. Yu, S. Yang, J.-B. Xu, and L. Xu, Phys. Rev. B 106, 165124 (2022)

  55. [63]

    T. W. B. Kibble, Journal of Physics A: Mathematical and General 9, 1387 (1976)

  56. [64]

    W. H. Zurek, Nature317, 505 (1985)

  57. [65]

    Polkovnikov, Phys

    A. Polkovnikov, Phys. Rev. B72, 161201 (2005)

  58. [66]

    W. H. Zurek, U. Dorner, and P. Zoller, Phys. Rev. Lett. 95, 105701 (2005)

  59. [67]

    Dziarmaga, Phys

    J. Dziarmaga, Phys. Rev. Lett.95, 245701 (2005)

  60. [68]

    Ashkin and E

    J. Ashkin and E. Teller, Phys. Rev.64, 178 (1943)

  61. [69]

    Kohmoto, M

    M. Kohmoto, M. den Nijs, and L. P. Kadanoff, Phys. 15 Rev. B 24, 5229 (1981)

  62. [70]

    H. J. Schulz, Phys. Rev. B28, 2746 (1983)

  63. [71]

    4,013093(2022)

    S.NyckeesandF.Mila,Phys.Rev.Res. 4,013093(2022)

  64. [72]

    B. E. Lüscher, F. Mila, and N. Chepiga, Phys. Rev. B 108, 184425 (2023)

  65. [73]

    Chepiga, Phys

    N. Chepiga, Phys. Rev. B108, 054509 (2023)

  66. [74]

    suggests that these lines merge into an Ashkin-Teller line for the Z+ 2 and Z4 orders, but the scenario forZ+ 3 and Z6 orders remains unresolved. Additionally, at what value of∆/Ω can the existence of the FL phase between the Z+ 4 and Z6 orders be most easily detected? Further...

  67. [75]

    Numerical investigation of quantum phases and phase transitions in a two-leg lad- der of rydberg atoms,

    J. S. Garcia and N. Chepiga, “Numerical investigation of quantum phases and phase transitions in a two-leg lad- der of rydberg atoms,” (2024), arXiv:2411.05494 [cond- mat.quant-gas]

Pith tools

Reviewed August 11, 2026 · model on record in the stance chip above.