pith. sign in

arxiv: 0912.3937 · v1 · pith:S3BN2JZHnew · submitted 2009-12-21 · ❄️ cond-mat.supr-con · cond-mat.mes-hall

Domain wall in a chiral p-wave superconductor: a pathway for electrical current

classification ❄️ cond-mat.supr-con cond-mat.mes-hall
keywords chiralchargedomainedgeeffectelectricalp-wavesuperconductor
0
0 comments X
read the original abstract

Superconductors with p+ip pairing symmetry are characterized by chiral edge states, but these are difficult to detect in equilibrium since the resulting magnetic field is screened by the Meissner effect. Nonequilibrium detection is hindered by the fact that the edge excitations are unpaired Majorana fermions, which cannot transport charge near the Fermi level. Here we show that the boundary between p_x+ip_y and p_x-ip_y domains forms a one-way channel for electrical charge. We derive a product rule for the domain wall conductance, which allows to cancel the effect of a tunnel barrier between metal electrodes and superconductor and provides a unique signature of topological superconductors in the chiral p-wave symmetry class.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.