pith. sign in

arxiv: 1809.00951 · v1 · pith:7UELR5KGnew · submitted 2018-09-04 · ⚛️ physics.plasm-ph

Generation of rogue waves in space dusty plasmas

classification ⚛️ physics.plasm-ph
keywords darwsdustyplasmawavesdawsfastgenerationmodes
0
0 comments X
read the original abstract

The basic features of dust-acoustic (DA) waves (DAWs) in four component dusty plasma system (containing inertial cold and hot dust grains, inertialess non-extensive ions and electrons) have been theoretically investigated by deriving the nonlinear Schr\"{o}dinger equation. The analytic analysis under consideration demonstrates two types of modes, namely, fast and slow DA modes. The unstable domain for the fast DA mode, which can be recognized by the critical wave number ($k_c$), gives rise to the DA rogue waves (DARWs). It is observed that the amplitude and width of the DARWs are significantly modified by various plasma parameters. The present results should be useful in understanding the conditions for modulational instability of DAWs and generation of DARWs in space dusty plasma systems like Saturn F-rings.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.