Formation of the Planetary Sequence in a Highly Flattened Disk of Frequently Colliding Planetesimals

(2) Academia Sinica Institute of Astronomy; Astrophysics (ASIAA); Ben-Gurion University of the Negev; Chi Yuan (2) ((1) Department of Physics; David Eichler (1); Edward Liverts (1); Evgeny Griv (1); Israel; Michael Gedalin (1); Taiwan)

arxiv: astro-ph/0012101 · v1 · submitted 2000-12-05 · 🌌 astro-ph

Formation of the Planetary Sequence in a Highly Flattened Disk of Frequently Colliding Planetesimals

Evgeny Griv (1) , Michael Gedalin (1) , Edward Liverts (1) , David Eichler (1) , Chi Yuan (2) ((1) Department of Physics , Ben-Gurion University of the Negev , Israel , (2) Academia Sinica Institute of Astronomy

show 2 more authors

Astrophysics (ASIAA) Taiwan)

This is my paper

classification 🌌 astro-ph

keywords diskplanetesimalskineticplanetarysequenceaccountaperiodicboltzmann

0 comments

read the original abstract

The kinetic theory is used to study the evolution of the self-gravitating disk of planetesimals. The effects of frequent collisions between planetesimals are taken into account by using a Krook integral in the Boltzmann kinetic equation. It is shown that as a result of an aperiodic collision-dissipative instability of small gravity disturbances the disk is subdivided into numerous dense fragments. These can eventually condense into the planetary sequence.

This paper has not been read by Pith yet.

Formation of the Planetary Sequence in a Highly Flattened Disk of Frequently Colliding Planetesimals

discussion (0)