pith. sign in

arxiv: astro-ph/0012101 · v1 · submitted 2000-12-05 · 🌌 astro-ph

Formation of the Planetary Sequence in a Highly Flattened Disk of Frequently Colliding Planetesimals

classification 🌌 astro-ph
keywords diskplanetesimalskineticplanetarysequenceaccountaperiodicboltzmann
0
0 comments X
read the original abstract

The kinetic theory is used to study the evolution of the self-gravitating disk of planetesimals. The effects of frequent collisions between planetesimals are taken into account by using a Krook integral in the Boltzmann kinetic equation. It is shown that as a result of an aperiodic collision-dissipative instability of small gravity disturbances the disk is subdivided into numerous dense fragments. These can eventually condense into the planetary sequence.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.