Massive scalar field instability in Kerr spacetime
classification
🌀 gr-qc
astro-ph
keywords
fieldscalarinstabilitykerrmassivespacetimeamplitudebecomes
read the original abstract
We study the Klein-Gordon equation for a massive scalar field in Kerr spacetime in the time-domain. We demonstrate that under conditions of super-radiance, the scalar field becomes unstable and its amplitude grows without bound. We also estimate the growth rate of this instability.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.