Pith. sign in

REVIEW 2 cited by

Massive White Dwarfs in the 100 pc Sample: Magnetism, Rotation, Pulsations, and the Merger Fraction

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2407.04827 v1 pith:VTGOD7BI submitted 2024-07-05 astro-ph.SR

classification astro-ph.SR
keywords whitesampledwarfsmassivefractionmergerodotmagnetic
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
abstract

We present a detailed model atmosphere analysis of massive white dwarfs with $M > 0.9~M_\odot$ and $T_{\rm eff}\geq11,000$ K in the Montreal White Dwarf Database 100 pc sample and the Pan-STARRS footprint. We obtained follow-up optical spectroscopy of 109 objects with no previous spectral classification in the literature. Our spectroscopic follow-up is now complete for all 204 objects in the sample. We find 118 normal DA white dwarfs, including 45 massive DAs near the ZZ Ceti instability strip. There are no normal massive DBs: the six DBs in the sample are strongly magnetic and/or rapidly rotating. There are 20 massive DQ white dwarfs in our sample, and all are found in the crystallization sequence. In addition, 66 targets are magnetic (32% of the sample). We use magnetic white dwarf atmosphere models to constrain the field strength and geometry using offset dipole models. We also use magnetism, kinematics, and rotation measurements to constrain the fraction of merger remnant candidates among this population. The merger fraction of this sample increases from 25% for 0.9-$1~M_{\odot}$ white dwarfs to 49% for 1.2-$1.3~M_{\odot}$. However, this fraction is as high as $78_{-7}^{+4}$% for 1.1-$1.2~M_{\odot}$ white dwarfs. Previous works have demonstrated that 5-9% of high-mass white dwarfs stop cooling for $\sim8$ Gyr due to the $^{22}$Ne distillation process, which leads to an overdensity of Q-branch stars in the solar neighborhood. We demonstrate that the over-abundance of the merger remnant candidates in our sample is likely due to the same process.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Circumstellar interaction in the extreme white dwarf merger remnant ZTF\,J1901+1458: A new class of white dwarf merger remnants with X-ray emission

    astro-ph.SR 2025-09 conditional novelty 8.0 of 10

    ZTF J1901+1458, an ultra-massive, highly magnetized white dwarf merger remnant, emits soft X-rays that pulse with its 7-minute rotation and are likely powered by circumstellar material interacting with its magnetosphere.

  2. Searching the non-accreting white dwarf population in eROSITA data

    astro-ph.HE 2025-01 conditional novelty 5.0 of 10

    Lowering the eROSITA energy threshold to 0.1 keV reveals soft white dwarf sources missed at 0.2 keV, and the German half-sky already hosts 264 high-confidence white dwarf candidates.

Pith tools