Pith. sign in

REVIEW 1 cited by

Learning Networked Dynamical System Models with Weak Form and Graph Neural Networks

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2407.16779 v1 pith:VOJH5EBG submitted 2024-07-23 eess.SY cs.SY

classification eess.SYcs.SY
keywords dynamicssystemslearningweakwldmformnetworkedframework
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

This paper presents a sequence of two approaches for the data-driven control-oriented modeling of networked systems, i.e., the systems that involve many interacting dynamical components. First, a novel deep learning approach named the weak Latent Dynamics Model (wLDM) is developed for learning generic nonlinear dynamics with control. Leveraging the weak form, the wLDM enables more numerically stable and computationally efficient training as well as more accurate prediction, when compared to conventional methods such as neural ordinary differential equations. Building upon the wLDM framework, we propose the weak Graph Koopman Bilinear Form (wGKBF) model, which integrates geometric deep learning and Koopman theory to learn latent space dynamics for networked systems, especially for the challenging cases having multiple timescales. The effectiveness of the wLDM framework and wGKBF model are demonstrated on three example systems of increasing complexity - a controlled double pendulum, the stiff Brusselator dynamics, and an electrified aircraft energy system. These numerical examples show that the wLDM and wGKBF achieve superior predictive accuracy and training efficiency as compared to baseline models. Parametric studies provide insights into the effects of hyperparameters in the weak form. The proposed framework shows the capability to efficiently capture control-dependent dynamics in these systems, including stiff dynamics and multi-physics interactions, offering a promising direction for learning control-oriented models of complex networked systems.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Physics-Infused Reduced-Order Modeling for Analysis of Multi-Layered Hypersonic Thermal Protection Systems

    physics.comp-ph 2025-05 conditional novelty 6.0 of 10

    PIROM couples a lumped-capacitance heat model with Mori-Zwanzig-derived hidden-state corrections and generalizes to unseen heat flux and material perturbations with roughly 1% NRMSE at 100x speedup.

Pith tools