Pith. sign in

REVIEW 5 major objections 4 minor 32 references

Kolmogorov analysis of JWST deep survey galaxies

T0 review · 5 major / 4 minor · reviewed 2026-08-16 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read Using the Kolmogorov stochasticity parameter on 148 JWST galaxy spectra, this paper claims the randomness properties of the peak-wavelength distribution change at z≈2.7 with >99% confidence.

desk verdict A clean application of KSP to JWST spectra, but the claimed z≈2.7 break is unsupported by the statistics as presented. read the letter →

arxiv 2504.17208 v2 pith:ENB4AWMR submitted 2025-04-24 astro-ph.GA

N. Galikyan , A.A. Kocharyan , V.G. Gurzadyan This is my paper · ORCID
classification astro-ph.GA
keywords KolmogorovstochasticityparametergalaxyspectraJWSTNIRSpecredshiftevolutionUNCOVERsurveyspectralpeakwavelengthsgeneralizednormaldistributionintergalacticmedium
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper uses the Kolmogorov stochasticity parameter, a statistic that measures how far a sorted sample's cumulative distribution departs from a reference distribution, to search for redshift-dependent changes in JWST galaxy spectra. Applying it to the rest-frame wavelengths of the brightest spectral peaks of 148 galaxies from the UNCOVER NIRSpec survey, the authors claim that the randomness properties of this wavelength distribution change sharply at redshift about 2.7, at over 99 percent confidence. If the claim holds, it indicates that the balance between regular and stochastic components of these galaxy spectra is not constant across cosmic time, and that something—either in the galaxies or in the intergalactic medium—alters the signal near that redshift. The authors treat the result as a new signature to be confirmed with other data and methods.

What carries the argument

The machinery is the Kolmogorov stochasticity parameter, defined as λ_n = sqrt(n) sup_x |F_n(x) - F(x)|, where F_n is the empirical cumulative distribution of the sorted sample and F is a theoretical cumulative distribution. Kolmogorov's theorem gives a universal limiting distribution for this statistic that is independent of F, allowing it to serve as an objective measure of comparative randomness. The paper applies it to the normalized wavelength sequence in redshift windows, generates one thousand mock samples from a generalized normal distribution to define the expected value and the 99 percent confidence interval, and uses a moving average with Δz = 0.1 to locate the transition.

What would settle it

Re-run the Kolmogorov analysis on mock spectra that place the same underlying emission line at each observed wavelength with realistic NIRSpec noise; if the z≈2.7 excursion also appears when the input signal has no redshift dependence, the claimed transition is an artifact of noise or calibration.

Watch

Extended reading notes

Core claim

The central claim is that the Kolmogorov stochasticity parameter of the rest-frame peak wavelengths, normalized per redshift interval to zero mean and unit variance and compared against a generalized normal distribution, departs from the mock-data expectation in a redshift-dependent way. The departure grows to about 4 sigma and, after moving-average smoothing over a redshift window of 0.1, marks a transition at z≈2.7. The authors interpret this as a change in the relative weight of random and regular sub-signals in the galactic spectra at that redshift, possibly tied to the intergalactic medium or to galaxy evolution. They report the result at over 99 percent confidence.

Load-bearing premise

The result depends on detector noise and calibration systematics being identical across the entire redshift range, so that the only thing changing with redshift is the galaxy signal itself.

Editorial extensions

If this is right

  • The spectral peak wavelength distribution of JWST galaxies is not statistically stationary across the redshift range 1.86 to 7.05.
  • A change at z≈2.7 means the random-regular mix in the emission lines differs at higher redshift, so galaxy samples above and below that redshift should not be pooled without accounting for the difference.
  • If astrophysical in origin, the transition provides a new redshift marker for galaxy or intergalactic-medium evolution that is independent of traditional photometric or color diagnostics.
  • The same Kolmogorov analysis can be applied to other emission lines and to other deep surveys to test whether the transition is line-specific or a general spectral property.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • A direct test of the interpretation is to compute the same statistic on other rest-frame lines, such as [O III] or H-beta, in the same galaxies; if the z≈2.7 transition reflects changing interstellar-medium conditions, it should also appear in those lines, while a wavelength-dependent instrumental effect would shift or vanish.
  • The 148-galaxy sample spans a wide range of signal-to-noise; removing the lowest-quality spectra or requiring secure redshift flags would show whether a few faint objects drive the 4-sigma excursion.
  • Because the Kolmogorov statistic is computed from peak wavelengths only, a redshift-dependent mix of galaxy types, such as active galactic nuclei versus star-forming galaxies, could mimic the signal; classifying galaxies independently would distinguish population mixing from a true spectral change.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

5 major / 4 minor

Summary. This Letter applies the Kolmogorov stochasticity parameter (KSP) to JWST/NIRSpec spectra of 148 galaxies from the UNCOVER survey, selected to have their spectral maximum near rest-frame 656 nm and spanning redshifts 1.86–7.05. For 1000 random redshift intervals each containing 10–20 galaxies, the authors compute the KSP of the normalized wavelength values and compare it with mock data drawn from a generalized normal distribution with unit variance. They report deviations up to 4σ, smooth the KSP sequence with a moving average of Δz = 0.1, and conclude that the spectral properties change at z ≃ 2.7 at over 99% confidence level, which they attribute to possible evolution of galaxies or the intergalactic medium.

Significance. If the claimed break at z ≃ 2.7 were robust, it would point to a genuine redshift-dependent change in the distribution of rest-frame spectral peaks in high-redshift JWST galaxies, with potential implications for galaxy evolution or IGM studies. The paper uses a publicly available dataset and a well-defined statistical quantity, the KSP, and it makes a concrete, falsifiable prediction about where the change occurs. However, the central claim is not supported by the statistical analysis as presented: the significance estimate ignores the strong correlation among overlapping redshift windows, the break redshift is selected post hoc, the null distribution is under-specified, and the crucial assumption of redshift-independent instrumental noise is stated but untested. As a result, the paper currently does not provide convincing evidence for the claimed effect.

major comments (5)
  1. [Section 4] The shape parameter of the generalized normal distribution is never specified. The text states that a 'generalized normal distribution with variance equal to 1' is used as the theoretical distribution and that there is 'a single free parameter representing the sharpness of the distribution,' but the value of that parameter is not given. Because the mock-data comparison in Figs. 2–4 is the only basis for the reported 99% confidence, the entire null distribution is under-defined and the analysis cannot be reproduced.
  2. [Section 4, Figs. 2–3] The 1000 redshift intervals are heavily overlapping, with each containing only 10–20 of the 148 galaxies. The KSP values in adjacent intervals are therefore strongly correlated, yet the 99% confidence intervals and the σλ used to compute Δλ/σλ in Fig. 3 are pointwise. A 4σ excursion somewhere in a long, correlated sequence is not a 4σ detection; the paper provides no correction for the effective number of independent intervals or for multiple testing.
  3. [Section 4, Fig. 4 and Section 5] The transition redshift z ≃ 2.7 is identified only after inspecting the smoothed KSP curve. No change-point test is performed, and no look-elsewhere penalty is applied. The paper's headline statement that the change is at 'over a 99% confidence level' is therefore not supported: the redshift is effectively a free parameter chosen to maximize the deviation, so the quoted confidence is circular.
  4. [Section 5] The conclusion explicitly requires that 'the instrumental noise and certain systematics are identical for the galaxies of the dataset,' but this assumption is not tested. Because the rest-frame 656 nm peak shifts from about 1.9 μm at z = 1.86 to about 5.3 μm at z = 7.05, the observed-frame position moves across substantially different JWST/NIRSpec sensitivity, resolution, and calibration regimes. Redshift-dependent systematics could easily produce a spurious apparent break, and the analysis offers no control, such as splitting the sample by wavelength or comparing against galaxies with different rest-frame lines.
  5. [Section 4] The normalization of wavelength values to zero mean and unit variance before comparison with a fixed theoretical distribution invalidates the use of the Kolmogorov distribution Φ(λ) in Eq. (2) as the null distribution, because the data are no longer i.i.d. samples from the assumed distribution with known parameters. The paper does not state whether the mock data are normalized in the same way; if they are not, the null is mismatched, and if they are, the effective null distribution differs from the analytical KSP distribution due to the estimation of mean and variance. Either way, the quoted significance levels are not justified.
minor comments (4)
  1. [Section 4, sentence after Eq. (3)] The text contains a typo: 'di fference' should be 'difference'.
  2. [Introduction] The reference 'Roberston et al 2023' appears in the text, but the reference list contains 'Robertson B.E., Tacchella S., Johnson B.D. et al, 2022'; the spelling and year should be corrected.
  3. [Fig. 2 caption] The caption reads 'horizontal error bars indicate the selected [z1; z2] intervals,' but these are the horizontal segments of the blue points; the term 'error bars' is misleading. Clarify the visualization.
  4. [Abstract and Section 5] The phrase 'at over a 99% confidence level' is not formally defined as a frequentist confidence interval; specify whether this is a pointwise significance level after smoothing, and state the exact test used.

Circularity Check

0 steps flagged · score 0.0 of 10

No formal circularity; the KSP analysis is a self-contained Monte Carlo comparison, though the z≈2.7 break is affected by post hoc selection and overlapping-bin correlations.

full rationale

The paper's central claim is that the Kolmogorov stochasticity parameter (KSP) of rest-frame 656 nm peak wavelengths changes at z≈2.7 at over 99% confidence. The derivation is self-contained: the KSP statistic is defined in Eq. (2) against a chosen theoretical distribution (a generalized normal with variance 1), mock data are generated from that same distribution, and the observed KSP values are compared to the mock distribution. Normalizing the observed wavelengths to zero mean and unit variance does not make the comparison circular, because the empirical cumulative distribution function's shape remains free; the mocks provide a calibrated null for the chosen parametric family. The self-citations to Gurzadyan and Kocharyan (2008) and related papers are historical examples of the method's prior applications, not inputs to the current calculation. No uniqueness theorem is invoked, and no ansatz is smuggled in via citation. The location z≈2.7 is identified post hoc from the smoothed KSP curve, and the 99% confidence intervals are pointwise and do not account for the heavy overlap of the 1000 random redshift intervals or the moving-average smoothing; these are legitimate statistical validity concerns, but they are not circularity in the sense of the result being equivalent to its inputs by construction. The paper itself concedes an untested crucial assumption that 'instrumental noise and certain systematics are identical for the galaxies of the dataset' (Section 5); this is a correctness risk, not a circular step. Therefore no circularity score is warranted.

Assumptions & free parameters 3 free parameters · 5 assumptions · 0 invented entities

The central claim rests on a data-matched null distribution and a post hoc transition redshift. The main free parameters are the shape parameter of the generalized normal model, the smoothing window, and the location of the transition. The key domain assumptions are the homogeneity of the sample across redshift and the constancy of instrumental noise.

free parameters (3)
  • Generalized normal shape parameter = not stated
    The theoretical distribution used for the KSP has a single free shape parameter; the text does not say whether it is fixed or estimated from the data, and no value is given.
  • Transition redshift z ~ 2.7 = ~2.7
    The location of the claimed change is chosen after inspecting the smoothed KSP curve, so it is effectively a parameter fitted to the data.
  • Moving average window Delta z = 0.1 = 0.1
    The smoothing window is chosen by hand and affects the apparent significance and location of the transition.
assumptions (5)
  • standard math Kolmogorov's theorem gives the limit distribution of the KSP for continuous CDFs.
    Invoked in Section 2 via Kolmogorov 1933; used to define the KSP statistic.
  • domain assumption The normalized wavelength values in each redshift interval follow a generalized normal distribution with variance 1.
    Assumed in Section 4 to define the theoretical CDF for the KSP; no goodness-of-fit test is shown.
  • domain assumption Instrumental noise and systematics are identical for all galaxies in the sample.
    Stated as crucial in Section 5, but not demonstrated; NIRSpec noise and calibration vary with wavelength and redshift.
  • domain assumption The selected galaxies (peak near 656 nm rest frame) form a homogeneous sample across redshift.
    Implicit in Section 3; selection near the spectral edge at high z may introduce redshift-dependent biases.
  • domain assumption KSP remains an efficient randomness indicator for samples of 10-20 points.
    Cited from Arnold 2008a; no convergence checks for such small n are provided.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Kolmogorov analysis of JWST deep survey galaxies." pith.science (2026). https://pith.science/paper/ENB4AWMR

@misc{pith2026250417208,
  author       = {Pith},
  title        = {Pith review of: Kolmogorov analysis of JWST deep survey galaxies},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/ENB4AWMR}},
  note         = {Machine review of arXiv:2504.17208}
}
read the original abstract

JWST galaxy deep spectral surveys provide a unique opportunity to trace a broad range of evolutionary features of galaxies and the intergalactic medium given the huge distance the photons are propagating. We have analyzed the spectral data of JWST galaxies up to a redshift of around 7 using the Kolmogorov technique, which is an efficient tool for testing the tiny comparative randomness properties of cumulative signals, that is, for distinguishing the contributions of regular and stochastic sub-signals. Our aim is to determine if certain identical spectral features of galaxies have undergone any distortions or systematic evolution across a broad range of redshifts. Our results indicate a change in the spectral properties of the sample galaxies at around z \simeq 2.7 at over a 99% confidence level.

Figures

Figures reproduced from arXiv: 2504.17208 by the authors.

Figure 2
Figure 2. Redshift dependence of the KSP λ of the galaxy emission corresponding to the maximum of the spectrum. Blue points denote the KSP values calculated for the observed galaxies, and horizontal error bars indicate the selected [z1;z2] intervals. Black points indicate the median of the mock data KSP, and the vertical error bars are the 99% confidence intervals around the medians of the generated data [PITH_FULL_IMAGE:fig… view at source ↗
Figure 1
Figure 1. Dependence of the wavelength on the redshift of the [PITH_FULL_IMAGE:figures/full_fig_p002_1.png] view at source ↗
Figure 4
Figure 4. Moving average of Fig. 2 with window [PITH_FULL_IMAGE:figures/full_fig_p003_4.png] view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

32 extracted references · 19 canonical work pages

  1. [1]

    Arnold V.I., 2008a, Nonlinearity, 21, T109

    work page

  2. [2]

    Arnold V.I., 2008b, Uspekhi Mat.Nauk, 63, 5

    work page

  3. [3]

    Moscow Math

    Arnold V.I., 2009a, Trans. Moscow Math. Soc., 70, 31

  4. [4]

    Arnold V.I., 2009b, Funct. An. Other Math. 2, 139

  5. [5]

    Atto A.M., Berthoumieu Y., Megret R., 2013, Entropy, 15, 4782

    2013

  6. [6]

    Bezanson R., Labbe I., Whitaker K. E. et al., 2024, ApJ, 974, 92

    work page 2024

  7. [7]

    et al, 2025, arXiv:2502.18310

    Cooper R.A., Caputi K.I., Iani E. et al, 2025, arXiv:2502.18310

    arXiv 2025

  8. [8]

    et al, 2014, A&A, 565, L3

    De Paolis F., Gurzadyan V.G., Nucita A.A. et al, 2014, A&A, 565, L3

    work page 2014

Show all 32 references
  1. [9]

    et al, 2025, arXiv:2503.03431

    D'Silva J.C.J., Driver S.P., Lagos C.D.P. et al, 2025, arXiv:2503.03431

    2025 arXiv

  2. [10]

    and Kocharyan A.A., 2008, A&A 492, L33

    Gurzadyan V.G. and Kocharyan A.A., 2008, A&A 492, L33

    2008

  3. [11]

    et al, 2009, A&A, 497, 343

    Gurzadyan V.G., Allahverdyan A.E., Ghahramanyan T. et al, 2009, A&A, 497, 343

    2009

  4. [12]

    Gurzadyan V.G., Kashin A.L., Khachatryan H.G., et al, 2010, EPL, 91, 19001

    2010

  5. [13]

    et al, 2011, EPL, 95, 69001

    Gurzadyan V.G., Durret F., Ghahramanyan, T. et al, 2011, EPL, 95, 69001

    2011

  6. [14]

    et al, 2014, A&A 566, A135

    Gurzadyan V.G., Kashin A.L., Khachatryan H.G. et al, 2014, A&A 566, A135

    2014

  7. [15]

    Gurzadyan V.G., Stepanian A., 2021, A&A 653, A145

    2021

  8. [16]

    Gurzadyan V.G., Fimin N.N., Chechetkin V.M., 2023, A&A, 677, A161

    2023

  9. [17]

    Gurzadyan V.G., Fimin N.N., Chechetkin V.M., 2025, A&A, 694, A252

    2025

  10. [18]

    et al, 2022, A&A, 661, A80

    Jakobsen P., Ferruit P., Alves de Oliveira C. et al, 2022, A&A, 661, A80

    2022

  11. [19]

    Kolmogorov A.N., 1933, G.Ist.Ital.Attuari 4, 83

    1933

  12. [20]

    et al, 2025, arXiv:2503.07774

    Liu F.Y., Dunlop J.S., McLure R.J. et al, 2025, arXiv:2503.07774

    2025

  13. [21]

    W., Feinberg L.D., Perrin M.D

    McElwain M. W., Feinberg L.D., Perrin M.D. et al. Publ. Astron. Soc. Pac., 2023, 135, 058001

    2023

  14. [22]

    et al, 2025, arXiv:2503.01579

    Martis N., Withers S., Felicioni G. et al, 2025, arXiv:2503.01579

    2025 arXiv

  15. [23]

    Mistele T., McGaugh A., Lelli F., et al, 2024, ApJL, 969, L3

    2024

  16. [24]

    et al, 2025, arXiv:2503.15594

    Pérez-González P.G., Östlin G., Costantin L. et al, 2025, arXiv:2503.15594

    2025

  17. [25]

    H., Bezanson R., Labbe I., et al

    Price S. H., Bezanson R., Labbe I., et al. 2024, arXiv:2408.03920

    2024 arXiv

  18. [26]

    et al, 2022, ApJL, 942, L42

    Robertson B.E., Tacchella S., Johnson B.D. et al, 2022, ApJL, 942, L42

    2022

  19. [27]

    et al, 2025, arXiv:2502.19174

    Runnholm A., Hayes M.J., Mehta V. et al, 2025, arXiv:2502.19174

    2025 arXiv

  20. [28]

    et al, 2025, arXiv:2503.15587

    Sun F., Fudamoto Y., Lin X. et al, 2025, arXiv:2503.15587

    2025 arXiv

  21. [29]

    et al, 2015, MNRAS, 450, 11

    Szapudi I., Kovacs A., Granett B.G. et al, 2015, MNRAS, 450, 11

    2015

  22. [30]

    et al, 2025, MNRAS, 539, 347

    Varnish T.W.O., Wu X., Pearson C. et al, 2025, MNRAS, 539, 347

    2025

  23. [31]

    , " * write output.state after.block = add.period write newline

    ENTRY address author booktitle chapter edition editor howpublished institution journal key month note number organization pages publisher school series title type volume year label extra.label sort.label short.list INTEGERS output.state before.all mid.sentence after.sentence a...

  24. [32]

    write newline

    " write newline "" before.all 'output.state := FUNCTION n.dashify 't := "" t empty not t #1 #1 substring "-" = t #1 #2 substring "--" = not "--" * t #2 global.max substring 't := t #1 #1 substring "-" = "-" * t #2 global.max substring 't := while if t #1 #1 substring * t #2 gl...

Pith tools

Reviewed August 16, 2026 · model on record in the stance chip above.