Pith. sign in

REVIEW 4 major objections 4 minor 2 cited by

exoALMA. XVIII. Interpreting large scale kinematic structures as moderate warping

T0 review · 4 major / 4 minor · reviewed 2026-08-06 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read Mild two-degree warps explain large-scale velocity spirals in disks.

desk verdict A useful warp-fitting framework for the exoALMA residuals, but the accretion-rate correlation is not yet established given the known geometric degeneracy and small sample. read the letter →

arxiv 2507.11669 v1 pith:PXQIBNB7 submitted 2025-07-15 astro-ph.EP astro-ph.SR

Andrew J. Winter , Myriam Benisty , Andrés F. Izquierdo , Giuseppe Lodato , Richard Teague , Carolin N. Kimmig , Sean M. Andrews , Jaehan Bae
show 23 more authors
Marcelo Barraza-Alfaro Nicolás Cuello Pietro Curone Ian Czekala Stefano Facchini Daniele Fasano Cassandra Hall Caitlyn Hardiman Thomas Hilder John D. Ilee Misato Fukagawa Cristiano Longarini François Ménard Ryuta Orihara Christophe Pinte Daniel J. Price Giovanni Rosotti Jochen Stadler David J. Wilner Lisa Wölfer Hsi-Wei Yen Tomohiro C. Yoshida Brianna Zawadzki
This is my paper
classification astro-ph.EPastro-ph.SR
keywords protoplanetarydisksdiskwarpskinematicsline-of-sightvelocityresidualsexoALMAm=1asymmetryscatteredlightspiralsstellaraccretion
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper argues that many of the large-scale, single-armed (m=1) velocity deviations seen in the exoALMA sample of protoplanetary disks are not planets, winds, or pressure effects but the projection of ordinary Keplerian rotation in a slightly warped disk. Tilt amplitudes of roughly 0.5–2 degrees between adjacent annuli, with a twist that advances steadily with radius, reproduce the observed residual maps for disks such as MWC 758 and CQ Tau. The same warps, fed into a radiative transfer model, produce spiral structure in scattered light and about 10 K variations in CO brightness temperature, matching observations of MWC 758. In the cleaned sample, the radially averaged warp amplitude correlates positively with stellar accretion rate, implying a physical link between the inner and outer disk. The authors present the warp interpretation as a simple benchmark, not a unique solution, and note that radial flows and pressure gradients are degenerate with it.

What carries the argument

The central object is the linearized projection identity δv_los(R, φ) = A(R) cos φ + B(R) sin φ, obtained by expanding the Keplerian azimuthal velocity under small perturbations to inclination and position angle. It converts two azimuthal Fourier coefficients of the observed residual map, A(R) and B(R), directly into radial tilt and twist profiles via δi = A/(v_phi cos i0) and δPA = B/(v_phi sin i0). A Gaussian-process fit to these profiles supplies smooth radial functions, their derivatives (the warp amplitude ψ = R $\sqrt$((∂i/∂R)^2 + $sin^{2}$ i (∂PA/∂R)^2)), and uncertainties; the same machinery feeds a radiative transfer model to predict scattered-light and brightness-temperature structure. This projection identity is the conceptual bridge that turns a purely geometric warp geometry into concrete, testable kinematic predictions.

What would settle it

A direct geometric test would resolve the disk surface in a strongly m=1 target and measure whether the apparent major-axis orientation twists with radius as the inferred δPA(R) profile requires; if instead the residual velocities are accompanied by resolved radial flows of comparable amplitude, the warp interpretation is falsified.

Watch

Extended reading notes

Core claim

The central claim is that a warped disk geometry—small, smooth radial variations in inclination δi(R) and position angle δPA(R)—naturally generates the m=1 line-of-sight velocity residuals that appear across the exoALMA sample. In the linearized model, the residual velocity on each annulus is δv_los = v_phi(R)[δi(R) cos i0 cos φ + δPA(R) sin i0 sin φ], so any coherent m=1 pattern can be mapped onto a radial tilt and twist profile. Applying this to the 12CO and 13CO residual maps yields tilt amplitudes β_max ~ 0.5–2 degrees for most moderately inclined disks, with larger and less reliable values for edge-on disks where the backside of the disk is visible. For MWC 758, the inferred warp also produces spiral arms in scattered light and ~10 K brightness-temperature fluctuations in radiative transfer calculations. The authors do not claim uniqueness: axisymmetric radial-flow or pressure-gradient models produce identical m=1 line-of-sight signatures, so the derived warp amplitudes should be read as maximal unless additional tracers break the degeneracy.

Load-bearing premise

The model interprets every large-scale line-of-sight velocity deviation as the projection of purely azimuthal Keplerian motion in a warped geometry, assuming radial flows, vertical bulk motions, pressure gradients, and winds contribute negligibly; if real disks have comparable radial motions, the inferred warp amplitudes and the accretion-rate correlation are biased.

Editorial extensions

If this is right

  • If the warp interpretation is right, many previously identified 'kinematic spirals' in protoplanetary disks are line-of-sight projection effects, not density waves or embedded planets.
  • Disk warps would be common (present in most exoALMA targets at some level), contradicting the default assumption that disks are planar.
  • A positive correlation between warp amplitude and stellar accretion rate implies that outer-disk geometry and inner-disk accretion are coupled, possibly through warp-driven angular momentum transport or shared infall history.
  • Warp-induced vertical motions ('sloshing') at the CO surface may heat or shock the gas, offering a mechanism for the SO emission seen in MWC 758 and CQ Tau.
  • Warp amplitudes inferred from 12CO and 13CO agree, so finite emission height does not strongly bias the derived tilt profiles for low-inclination disks.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Inference: If the accretion-rate correlation survives a larger sample, it would strengthen the case that late infall or companion-driven warp excitation, rather than internal instabilities, sets both outer-disk geometry and inner-disk fueling.
  • Inference: The same projection argument implies that any m=1 residual map can be fit by some warp; the model's predictive power will come from cross-checks that a single radial twist profile simultaneously explains kinematics, scattered-light shadows, and brightness-temperature patterns.
  • Inference: A testable extension would be to apply the method to disks observed at multiple inclinations or with higher angular resolution, where the predicted warp-induced curvature of the emission surface could be detected directly via surface-brightness asymmetries.
  • Inference: If warps are as common as claimed, then disk mass and turbulence measurements that assume axisymmetric planar geometry may be systematically biased, potentially affecting estimates of angular momentum transport.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

4 major / 4 minor

Summary. The paper proposes that the large-scale m=1 line-of-sight velocity residuals seen in exoALMA protoplanetary disks can be interpreted as the projection of Keplerian rotation in a moderately warped disk. The authors derive a linearized tilted-ring model in which annulus-averaged cosφ and sinφ velocity amplitudes are converted into radial inclination and position-angle perturbations δi(R) and δPA(R), and from these into physical tilt, twist, and warp-amplitude profiles. They apply the model to the exoALMA sample, present a detailed MWC 758 case study with RADMC-3D scattered-light and brightness-temperature comparisons, and search for correlations between the inferred warp metrics and disk/star properties. The paper is transparent that the interpretation is not unique and that the fitted profiles absorb axisymmetric radial/azimuthal flow contributions; nevertheless, these warp metrics are subsequently used in population-level correlations with accretion rate.

Significance. If the central interpretation is correct, the paper would reframe many large-scale kinematic spirals as geometric projection effects rather than dynamical perturbations, with implications for how disk turbulence, winds, and angular momentum transport are inferred from CO kinematics. The manuscript has genuine strengths: the linearized model is simple and clearly derived, the fits are applied consistently to a homogeneous survey sample, the 12CO/13CO and beam-size checks are useful robustness tests, and the authors publicly release fitting scripts and Gaussian-process posterior samples. However, the most novel quantitative result, the claimed correlation between warp amplitude and stellar accretion rate, is the least secure part of the paper because the fitted warp parameters are degenerate with axisymmetric flows, the sample has only eight objects, and no quantitative bound on flow contamination is provided. The warp interpretation is plausible, but the accretion-rate correlation is not established at the level claimed.

major comments (4)
  1. [Sec. 2.2, Eqs. (9)–(12)] The linearized model is a Fourier projection: A(R) and B(R) are the cosφ and sinφ amplitudes of the annulus residual, and in a flat disk an axisymmetric radial flow v_R contributes v_R sin i0 cosφ while an axisymmetric azimuthal perturbation δv_φ contributes δv_φ sin i0 sinφ. Both are therefore absorbed into δi and δPA by construction. The manuscript acknowledges this in Sec. 2.2 and Sec. 3.5 and labels the warp amplitude 'maximal', but Sec. 3.3 then treats βmax and ⟨logψ⟩ as physical warp amplitudes in the accretion-rate correlation (Figs. 7–8). The ambiguity is not hypothetical: MWC 758, the high-accretion/high-warp anchor of the correlation, has wind-like m=0 residuals after subtracting the warp (Sec. 3.2.3), and Sec. 3.2.2 lists HD 34282, LkCa15, PDS 66, SY Cha, and V4046 Sgr as cases where pressure-gradient residuals may inflate the warp amplitude. To make the correlation evidence for a warp–accretion link, the authors need a quantitative estimate of how much of the inferred δi(R) and δPA(R) can be generated by the expected radial-flow and pressure-support fields; an injection test that adds such flows to a flat disk and reruns the pipeline would provide this bound.
  2. [Sec. 3.3, Figs. 7–8] The population-level result rests on n=8 disks and on the influence of MWC 758, which is both the highest-accretion and a high-warp point. The three reported tests (Spearman, Kendall, permutation) are not independent because they use the same rank ordering, and four system properties are screened without any multiple-comparison correction. A leave-one-out analysis would show whether the reported p≈4×10−3 for ⟨logψ⟩ versus log(Ṁ/M*²) survives when MWC 758 is removed, and a bootstrap would give a confidence interval on the correlation coefficient. Without such tests, the abstract's statement that warp properties 'correlate with stellar accretion rates' overstates the robustness of the finding.
  3. [Sec. 3.4.2, Eq. (20)] The sloshing velocity estimate v_r,slosh ≈ (ψ/2α)Ωz gives values of several times the sound speed for α~10−3 and ψ~10−2, and the paper itself acknowledges that these motions 'will undoubtedly contribute' to the LOS velocity structure. Because sloshing produces coherent radial and azimuthal velocity components whose LOS projections have the same cosφ/sinφ form as the warp, the 12CO/13CO and beam-size checks in Sec. 3.2.5 do not separate sloshing from geometry. The statement that sloshing 'might act more like noise than a strong bias' is not demonstrated. This matters because the inferred βmax and ψ are precisely the quantities used in the accretion-rate correlations, so the sloshing contribution is a quantitative uncertainty in the paper's main new result, not merely a philosophical caveat.
  4. [Sec. 3.3, Eq. (16)] The averaged warp amplitude ⟨logψ⟩R is integrated over the fitted radial range ΔR, which differs substantially between disks (for example, R_out is 132 au for PDS 66 but 358 au for V4046 Sgr in Table 1). If ψ(R) has a radial trend, or if the outer fitted radii are limited by sensitivity rather than by disk structure, then ⟨logψ⟩ is not a homogeneous disk property and the correlation could be partly a function of radial coverage. The authors should test whether the accretion correlation survives when ⟨logψ⟩ is computed over a fixed physical annulus where all disks have data, or when R_out is included as a covariate.
minor comments (4)
  1. [Abstract and Table 1] The abstract describes 'moderate disk warps (~0.5–2°)' as the explanation, but Table 1 reports βmax values up to 10.2° (SY Cha) and 7.4° (HD 34282). The text later explains that high-inclination/backside-visible disks are excluded from the population analysis, but the abstract should state that the 0.5–2° range refers to the moderate-inclination subset used for correlations, not to the full sample.
  2. [Sec. 3.1.2 and Appendix B] The scattered-light and brightness-temperature demonstrations for MWC 758 rely on an arbitrary cubic-spline extrapolation of the warp profile into the inner disk, as stated in Appendix B and Sec. 3.1.2. This is acceptable as a proof of concept, but the abstract and Sec. 3.1.2 should use wording such as 'illustrate' or 'are consistent with' rather than 'demonstrate', given that the morphology is not quantitatively reproduced (e.g., the north spiral is not recovered).
  3. [Sec. 3.4.1, Eq. (17)] The warp oscillation period P_warp ≈ R/c_s is used only for order-of-magnitude estimates, but the actual bending-wave period differs by factors of order 2π; citing the precise linear-theory expression would avoid giving an impression of exactness.
  4. [Sec. 3.2.4 and Fig. 5] The color bar in Figure 5 shows the global inclination |i0| but the text says 'points being coloured by overall inclination of the system'; the caption should specify whether the sign convention used elsewhere in the paper is preserved in the color scale.

Circularity Check

1 steps flagged · score 4.0 of 10

The warp profiles are defined as the m=1 Fourier components of the observed residuals, so the kinematic 'explanation' is partly a reparameterization; independent scattered-light, brightness-temperature, and accretion checks keep the paper from being fully circular.

  1. self definitional [Section 2.2, Eqs. (9)-(12); Section 3.1.1]
    "We can then derive the inclination and position angle perturbations from the coefficients A(R) and B(R) as: δi(R) = A(R)/(vφ(R) cos i0), δPA(R) = B(R)/(vφ(R) sin i0). ... In Section 3 we fit indiscriminately for warp structures, but the success of this fit can be understood as the degree to which a disc conforms to this criterion."

    Equation 10 defines A(R) and B(R) as the cosφ and sinφ Fourier amplitudes of the observed residual δvlos. Equations 11-12 then define the fitted warp perturbations δi and δPA directly in terms of those amplitudes. Therefore the warp model's reproduction of the m=1 part of δvlos is an identity by construction: any residual field with m=1 symmetry is exactly re-encoded as a warp profile, so the 'fit success' only measures how much of the residual has m=1 symmetry, not whether warping is present. The paper acknowledges this by calling the result a 'maximal' tilt and stressing non-uniqueness in Section 3.5, which mitigates but does not remove the self-definitional character of the kinematic interpretation.

full rationale

The paper's central kinematic step is an explicit inversion: the warp parameters δi and δPA are defined as the cosine and sine components of the observed line-of-sight residual, so saying that a warp 'reproduces' an m=1 residual is a reparameterization rather than an independent test. This is a genuine self-definitional element, and it is the reason the kinematic 'explanation' cannot by itself confirm the warp hypothesis. However, the paper does not rest solely on that reproduction: it makes forward radiative-transfer comparisons of warped geometries to MWC 758's scattered light and CO brightness temperature, checks robustness against the 13CO isotopologue and different beam sizes, and correlates the derived amplitudes with externally measured accretion rates. Those accretion rates are not inputs to the warp fit, so the reported correlation is independent empirical content, although it inherits the radial-flow degeneracy as a systematic risk rather than a circularity. Self-citations to exoALMA companion papers and to Young et al. (2022) provide data, pipeline, and simulation context, but the warp-to-m=1 kinematic mapping is derived algebraically in Eqs. (9)-(12) and is not imported from those citations. Overall, the kinematic interpretation is partly definitional, but the independent observables give the paper substantive content; a moderate score is therefore appropriate.

Assumptions & free parameters 4 free parameters · 5 assumptions · 0 invented entities

The paper introduces no new physical entities. Its central claim rests on fitted warp profiles (free functions per disk), an arbitrary inner-disk extrapolation for the radiative transfer demonstration, and a set of standard but simplifying assumptions about Keplerian circular motion, small perturbations, and negligible non-azimuthal velocities. The latter assumption is the most fragile and is explicitly acknowledged by the authors as a degeneracy with radial flows and winds.

free parameters (4)
  • Warp profiles delta_i(R), delta_PA(R) for each disk = See Table 1 for derived beta_max values; full profiles in figures and Zenodo samples
    These are free functions fit to the residual velocity maps via least squares per annulus and GP smoothing. The central claim that warps explain the data depends entirely on these fitted profiles.
  • Inner extrapolation of delta_i, delta_PA for MWC 758 = Two arbitrary interior points (Appendix B)
    Used to produce the radiative transfer images; the scattered-light comparison depends on this arbitrary choice.
  • GP hyperparameters (Matern nu=2.5, length scale init at 2 beam sizes) = nu=2.5, length scale = 2 beams
    Chosen by hand; moderate sensitivity to these choices is not fully characterized.
  • CO emission surface self-shielding column, dust-to-gas ratio, flaring exponent = N_ss=1e15 cm^-2, dust/gas=1e-2, flaring exponent=1.03
    Assumed values for the brightness-temperature model; authors say results do not strongly depend on them.
assumptions (5)
  • domain assumption Orbital motion is circular and Keplerian: v_phi = sqrt(GM*/R)
    Used in Eq. 1 and throughout; standard for disk modeling, but excludes radial pressure support.
  • domain assumption Small perturbations: delta_i, delta_PA << 1 rad, so linearization applies
    Used in Eqs. 5-8 and in deriving tilt/twist; the fitted amplitudes are a few degrees, so this is reasonable but not exact.
  • ad hoc to paper All LOS velocity perturbations are attributed to the azimuthal component; radial and vertical velocities are neglected
    This is the key modeling choice made in Section 2.2 and acknowledged as degenerate in Section 3.5.
  • domain assumption The reference angular momentum vector is the unperturbed disc orientation from Discminer
    They note in Appendix A that warp coordinates depend on reference frame; the total angular momentum is unknown.
  • domain assumption Radiative transfer assumes vertically isothermal, hydrostatic equilibrium disc with well-coupled 0.1 micron dust
    Used in Section 3.1.2 for scattered light; simplified but reasonable for a proof-of-concept.

how reviews work

0 comments
Cite this review

Pith. "Pith review of exoALMA. XVIII. Interpreting large scale kinematic structures as moderate warping." pith.science (2026). https://pith.science/paper/PXQIBNB7

@misc{pith2026250711669,
  author       = {Pith},
  title        = {Pith review of: exoALMA. XVIII. Interpreting large scale kinematic structures as moderate warping},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/PXQIBNB7}},
  note         = {Machine review of arXiv:2507.11669}
}
abstract

The exoALMA program gave an unprecedented view of the complex kinematics of protoplanetary disks, revealing diverse structures that remain poorly understood. We show that moderate disk warps ($\sim 0.5-2^\circ$) can naturally explain many of the observed large-scale velocity features with azimuthal wavenumber $m = 1$. Using a simple model, we interpret line-of-sight velocity variations as changes in the projected Keplerian rotation caused by warping of the disk. While not a unique explanation, this interpretation aligns with growing observational evidence that warps are common. We demonstrate that such warps can also produce spiral structures in scattered light and CO brightness temperature, with $\sim 10$ K variations in MWC 758. Within the exoALMA sample, warp properties correlate with stellar accretion rates, suggesting a link between the inner disc and outer disc kinematics. If warps cause large-scale kinematic structure, this has far reaching implications for turbulence, angular momentum transport, and planet formation.

Figures

Figures reproduced from arXiv: 2507.11669 by the authors.

Figure 1
Figure 1. Top panels show residuals from the observed (left) vs modeled (right) δvlos fields for MWC 758 after fitting Keplerian velocity profiles. The flexible model is for a simple warped disc geometry, with perturbation in inclination and position angle. The colour scale is the LOS velocity in km/s. Grey circles mask two times the central beam size. The beam size is also shown on the left hand side, assumed circular for vi… view at source ↗
Figure 2
Figure 2. Visualisation of the warp structure via concentric rings with the profile for MWC 758 shown in [PITH_FULL_IMAGE:figures/full_fig_p007_2.png] view at source ↗
Figure 3
Figure 3. The total K-band polarised intensity map of MWC 758 (left, Ren et al. 2023) compared to the total intensity at 2.2 µm from our Radmc3d model (right). Both are masked inside 100 mas, which is the size of the coronograph. The contours of the right hand panel are 5, 10, 20 and 50 σ from the observed structure. We highlight that we do not have good constraints on warp structure inside of 150 mas, where we have assumed a… view at source ↗
Figures from the paper (4 more)
Figure 4
Figure 4. Figure 4: Residual brightness temperature of 12CO after subtracting an axisymmetric powerlaw as observed in MWC 758 (left) and our warped disc model at an estimated CO emission height (middle) and midplane from the model (right). The temperature quoted in each case is the differ…
Figure 5
Figure 5. Figure 5: The relationship between inclination and PA tilt amplitude, with points being coloured by overall inclination of the system. The points circled in red are those for which the backside of the disc is visible in the 12CO line profiles. values, with small ψ throughout the…
Figure 6
Figure 6. Figure 6: Comparison between the tilt amplitudes inferred using 12CO and 13CO isotopologues. The black dashed line shows 1 : 1 agreement. Points are coloured by the global inclination of the disc. The discs for which the backside is visible in the line profiles are circled in re…
Figure 7
Figure 7. Figure 7: From top to bottom, we show how the the con￾tinuum non-axisymmetric index (NAI, top – Curone et al. 2025), stellar accretion rates (middle top), normalised stel￾lar accretion rates (to the square of the stellar mass, bottom middle) and NIR excess (Garufi et al. 2018, b…

Discussion (0). Sign in to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Angular Momentum of Planet-Forming Disks: Implications for Infall Driven Misalignments

    astro-ph.EP 2026-07 conditional novelty 6.0 of 10

    Most Class II disks have lower total angular momentum than late Bondi–Hoyle cloud infall is predicted to supply, so late-stage streamers can reorient disks and explain observed misalignments.

  2. Angular Momentum of Planet-Forming Disks: Implications for Infall Driven Misalignments

    astro-ph.EP 2026-07 conditional novelty 6.0 of 10

    Most planet-forming disks have less angular momentum than late-infalling cloud gas is predicted to carry, so infalling streamers are a plausible cause of the observed misalignments.

Reference graph

Works this paper leans on

143 extracted references · 21 canonical work pages · cited by 1 Pith paper

  1. [1]

    , " * write output.state after.block = add.period write newline

    ENTRY address archivePrefix author booktitle chapter doi edition editor eprint howpublished institution journal key month number organization pages publisher school series title misctitle type volume year version url label extra.label sort.label short.list INTEGERS output.state before.all mid.sentence after.sentence after.block FUNCTION init.state.consts ...

  2. [2]

    write newline

    " write newline "" before.all 'output.state := FUNCTION format.url url empty "" new.block "" url * "" * if FUNCTION format.eprint eprint empty "" archivePrefix empty "" archivePrefix "arXiv" = new.block " " eprint * " " * new.block " " eprint * " " * if if if FUNCTION format.doi doi empty "" " " doi * " " * if FUNCTION format.pid doi empty eprint empty ur...

  3. [3]

    N=*J qs`Q+vs^Pݜ F)#&![sۜf !__ t s[gv UUN F Lޡ ]Af7= E^øl:E3 Cݚ TÛ W`Cz|S ` &` N uETr: 0x `P=e E go|8& ݂L 8e. =^ wyyAhG R' ꒗ 琝C=pEγH

    thebibliography [1] 20pt to REFERENCES 6pt =0pt -12pt 10pt plus 3pt =0pt =0pt =1pt plus 1pt =0pt =0pt -12pt =13pt plus 1pt =20pt =13pt plus 1pt \@M =10000 =-1.0em =0pt =0pt 0pt =0pt =1.0em @enumiv\@empty 10000 10000 `\.\@m \@noitemerr \@latex@warning Empty `thebibliography' environment \@ifnextchar \@reference \@latexerr Missing key on reference command E...

    2021

  4. [4]

    Alencar , S. H. P., Bouvier , J., Donati , J. F., et al. 2018, , 620, A195, 10.1051/0004-6361/201834263

    work page doi:10.1051/0004-6361/201834263 2018

  5. [5]

    F., Testi , L., et al

    Almendros-Abad , V., Manara , C. F., Testi , L., et al. 2024, , 685, A118, 10.1051/0004-6361/202348649

    doi:10.1051/0004-6361/202348649 2024

  6. [6]

    2024, , 527, 4777, 10.1093/mnras/stad3494

    Aly , H., Nealon , R., & Gonzalez , J.-F. 2024, , 527, 4777, 10.1093/mnras/stad3494

    work page doi:10.1093/mnras/stad3494 2024

  7. [7]

    P., et al

    Ansdell , M., Gaidos , E., Williams , J. P., et al. 2016 a , , 462, L101, 10.1093/mnrasl/slw140

    work page doi:10.1093/mnrasl/slw140 2016

  8. [8]

    A., et al

    Ansdell , M., Gaidos , E., Rappaport , S. A., et al. 2016 b , , 816, 69, 10.3847/0004-637X/816/2/69

    doi:10.3847/0004-637x/816/2/69 2016

Show all 143 references
  1. [9]

    J., & Pringle , J

    Armitage , P. J., & Pringle , J. E. 1997, , 488, L47, 10.1086/310907

    1997 doi

  2. [10]

    P., Garufi , A., et al

    Avenhaus , H., Quanz , S. P., Garufi , A., et al. 2018, , 863, 44, 10.3847/1538-4357/aab846

    2018 doi

  3. [11]

    D., et al

    Ballabio , G., Nealon , R., Alexander , R. D., et al. 2021, , 504, 888, 10.1093/mnras/stab922

    2021 doi

  4. [12]

    2025, , 984, L21, 10.3847/2041-8213/adc42d

    Barraza-Alfaro , M., Flock , M., B \'e thune , W., et al. 2025, , 984, L21, 10.3847/2041-8213/adc42d

    2025 doi

  5. [13]

    R., Lodato , G., & Pringle , J

    Bate , M. R., Lodato , G., & Pringle , J. E. 2010, , 401, 1505, 10.1111/j.1365-2966.2009.15773.x

    2010

  6. [14]

    Begeman , K. G. 1989, , 223, 47

    1989

  7. [15]

    2015, , 578, L6, 10.1051/0004-6361/201526011

    Benisty , M., Juhasz , A., Boccaletti , A., et al. 2015, , 578, L6, 10.1051/0004-6361/201526011

    2015 doi

  8. [16]

    2018, , 619, A171, 10.1051/0004-6361/201833913

    Benisty , M., Juh \'a sz , A., Facchini , S., et al. 2018, , 619, A171, 10.1051/0004-6361/201833913

    2018 doi

  9. [17]

    2023, in Astronomical Society of the Pacific Conference Series, Vol

    Benisty , M., Dominik , C., Follette , K., et al. 2023, in Astronomical Society of the Pacific Conference Series, Vol. 534, Protostars and Planets VII, ed. S. Inutsuka , Y. Aikawa , T. Muto , K. Tomida , & M. Tamura , 605, 10.48550/arXiv.2203.09991

    2023 doi arXiv

  10. [18]

    J., Benisty , M., Perraut , K., et al

    Bohn , A. J., Benisty , M., Perraut , K., et al. 2022, , 658, A183, 10.1051/0004-6361/202142070

    2022 doi

  11. [19]

    E., Bouy , H., & Barrado , D

    Bouvier , J., Grankin , K., Ellerbroek , L. E., Bouy , H., & Barrado , D. 2013, , 557, A77, 10.1051/0004-6361/201321389

    2013 doi

  12. [20]

    1999, , 349, 619

    Bouvier , J., Chelli , A., Allain , S., et al. 1999, , 349, 619

    1999

  13. [21]

    2022, ConeRot: Velocity perturbations extractor , Astrophysics Source Code Library, record ascl:2207.027

    Casassus , S. 2022, ConeRot: Velocity perturbations extractor , Astrophysics Source Code Library, record ascl:2207.027

    2022

  14. [22]

    2019, , 883, L41, 10.3847/2041-8213/ab4425

    Casassus , S., & P \'e rez , S. 2019, , 883, L41, 10.3847/2041-8213/ab4425

    2019 doi

  15. [23]

    2015, , 811, 92, 10.1088/0004-637X/811/2/92

    Casassus , S., Marino , S., P \'e rez , S., et al. 2015, , 811, 92, 10.1088/0004-637X/811/2/92

    2015 doi

  16. [24]

    2018, , 477, 5104, 10.1093/mnras/sty894

    Casassus , S., Avenhaus , H., P \'e rez , S., et al. 2018, , 477, 5104, 10.1093/mnras/sty894

    2018 doi

  17. [25]

    D., et al

    Codron , I., Kraus , S., Monnier , J. D., et al. 2025, arXiv e-prints, arXiv:2506.19668. 2506.19668

    2025 arXiv

  18. [26]

    M., Stauffer , J., Baglin , A., et al

    Cody , A. M., Stauffer , J., Baglin , A., et al. 2014, , 147, 82, 10.1088/0004-6256/147/4/82

    2014 doi

  19. [27]

    W., Grady , C

    Cox , A. W., Grady , C. A., Hammel , H. B., et al. 2013, , 762, 40, 10.1088/0004-637X/762/1/40

    2013 doi

  20. [28]

    Cuello , N., M \'e nard , F., & Price , D. J. 2023, European Physical Journal Plus, 138, 11, 10.1140/epjp/s13360-022-03602-w

    2023 doi

  21. [29]

    M., et al

    Curone , P., Facchini , S., Andrews , S. M., et al. 2025, , 984, L9, 10.3847/2041-8213/adc438

    2025 doi

  22. [30]

    2019, , 877, L3, 10.3847/2041-8213/ab1b42

    Currie , T., Marois , C., Cieza , L., et al. 2019, , 877, L3, 10.3847/2041-8213/ab1b42

    2019 doi

  23. [31]

    2016, , 595, A114, 10.1051/0004-6361/201629267

    de Boer , J., Salter , G., Benisty , M., et al. 2016, , 595, A114, 10.1051/0004-6361/201629267

    2016 doi

  24. [32]

    2023, , 948, 36, 10.3847/1538-4357/acbdf1

    Debes , J., Nealon , R., Alexander , R., et al. 2023, , 948, 36, 10.3847/1538-4357/acbdf1

    2023 doi

  25. [33]

    H., Jang-Condell , H., & Schneider , G

    Debes , J. H., Jang-Condell , H., & Schneider , G. 2016, , 819, L1, 10.3847/2041-8205/819/1/L1

    2016 doi

  26. [34]

    2025, arXiv e-prints, arXiv:2505.04699, 10.48550/arXiv.2505.04699

    Delfini , L., Vioque , M., Ribas , \'A ., & Hodgkin , S. 2025, arXiv e-prints, arXiv:2505.04699, 10.48550/arXiv.2505.04699

    2025 doi arXiv

  27. [35]

    Deng , H., & Ogilvie , G. I. 2022, , 512, 6078, 10.1093/mnras/stac858

    2022 doi

  28. [36]

    F., Gregory , S

    Donati , J. F., Gregory , S. G., Montmerle , T., et al. 2011, , 417, 1747, 10.1111/j.1365-2966.2011.19366.x

    2011

  29. [37]

    2011, , 141, 46, 10.1088/0004-6256/141/2/46

    Donehew , B., & Brittain , S. 2011, , 141, 46, 10.1088/0004-6256/141/2/46

    2011 doi

  30. [38]

    1995, , 300, 503

    Dorschner , J., Begemann , B., Henning , T., Jaeger , C., & Mutschke , H. 1995, , 300, 503

    1995

  31. [39]

    J., King , A

    Do g an , S., Nixon , C. J., King , A. R., & Pringle , J. E. 2018, , 476, 1519, 10.1093/mnras/sty155

    2018 doi

  32. [40]

    J., King , A

    Do g an , S., Nixon , C. J., King , A. R., Pringle , J. E., & Price , D. 2023, in IAU Symposium, Vol. 362, The Predictive Power of Computational Astrophysics as a Discover Tool, ed. D. Bisikalo , D. Wiebe , & C. Boily , 177--183, 10.1017/S1743921322001387

    2023 doi

  33. [41]

    P., Juhasz , A., Pohl , A., et al

    Dullemond , C. P., Juhasz , A., Pohl , A., et al. 2012, RADMC-3D: A multi-purpose radiative transfer tool , Astrophysics Source Code Library, record ascl:1202.015

    2012

  34. [42]

    P., Kimmig , C

    Dullemond , C. P., Kimmig , C. N., & Zanazzi , J. J. 2022, , 511, 2925, 10.1093/mnras/stab2791

    2022 doi

  35. [43]

    2018, , 473, 4459, 10.1093/mnras/stx2523

    Facchini , S., Juh \'a sz , A., & Lodato , G. 2018, , 473, 4459, 10.1093/mnras/stx2523

    2018 doi

  36. [44]

    Facchini , S., Lodato , G., & Price , D. J. 2013, , 433, 2142, 10.1093/mnras/stt877

    2013 doi

  37. [45]

    R., Oudmaijer , R

    Fairlamb , J. R., Oudmaijer , R. D., Mendigut \' a , I., Ilee , J. D., & van den Ancker , M. E. 2015, , 453, 976, 10.1093/mnras/stv1576

    2015 doi

  38. [46]

    E., Acke , B., et al

    Fedele , D., van den Ancker , M. E., Acke , B., et al. 2008, , 491, 809, 10.1051/0004-6361:200810126

    2008 doi

  39. [47]

    M., Simon , J

    Flaherty , K., Hughes , A. M., Simon , J. B., et al. 2020, , 895, 109, 10.3847/1538-4357/ab8cc5

    2020 doi

  40. [49]

    F., et al

    Galloway-Sprietsma , M., Bae , J., Izquierdo , A. F., et al. 2025, , 984, L10, 10.3847/2041-8213/adc437

    2025 doi

  41. [50]

    H., Isella , A., Li , H., et al

    Gardner , C. H., Isella , A., Li , H., et al. 2025, , 984, L16, 10.3847/2041-8213/adc432

    2025 doi

  42. [51]

    2018, , 620, A94, 10.1051/0004-6361/201833872

    Garufi , A., Benisty , M., Pinilla , P., et al. 2018, , 620, A94, 10.1051/0004-6361/201833872

    2018 doi

  43. [52]

    G., et al

    Garufi , A., Ginski , C., van Holstein , R. G., et al. 2024, , 685, A53, 10.1051/0004-6361/202347586

    2024 doi

  44. [53]

    2021, , 908, L25, 10.3847/2041-8213/abdf57

    Ginski , C., Facchini , S., Huang , J., et al. 2021, , 908, L25, 10.3847/2041-8213/abdf57

    2021 doi

  45. [54]

    A., Schneider , G., Sitko , M

    Grady , C. A., Schneider , G., Sitko , M. L., et al. 2009, , 699, 1822, 10.1088/0004-637X/699/2/1822

    2009 doi

  46. [55]

    R., Millman, K

    Harris, C. R., Millman, K. J., van der Walt, S. J., et al. 2020, Nature, 585, 357, 10.1038/s41586-020-2649-2

    2020 doi

  47. [56]

    J., Facchini , S., Clarke , C

    Haworth , T. J., Facchini , S., Clarke , C. J., & Cleeves , L. I. 2017, , 468, L108, 10.1093/mnrasl/slx037

    2017 doi

  48. [57]

    E., & Ogilvie , G

    Held , L. E., & Ogilvie , G. I. 2024, , 535, 3108, 10.1093/mnras/stae2487

    2024 doi

  49. [58]

    M., et al

    Hu \'e lamo , N., Chauvin , G., Schmid , H. M., et al. 2018, , 613, L5, 10.1051/0004-6361/201832874

    2018 doi

  50. [59]

    2013, , 767, 112, 10.1088/0004-637X/767/2/112

    Ingleby , L., Calvet , N., Herczeg , G., et al. 2013, , 767, 112, 10.1088/0004-637X/767/2/112

    2013 doi

  51. [60]

    F., Testi , L., Facchini , S., Rosotti , G

    Izquierdo , A. F., Testi , L., Facchini , S., Rosotti , G. P., & van Dishoeck , E. F. 2021, , 650, A179, 10.1051/0004-6361/202140779

    2021 doi

  52. [61]

    F., Stadler , J., Galloway-Sprietsma , M., et al

    Izquierdo , A. F., Stadler , J., Galloway-Sprietsma , M., et al. 2025, , 984, L8, 10.3847/2041-8213/adc439

    2025 doi

  53. [62]

    1994, , 292, 641

    Jaeger , C., Mutschke , H., Begemann , B., Dorschner , J., & Henning , T. 1994, , 292, 641

    1994

  54. [63]

    2017, , 466, 4053, 10.1093/mnras/stw3389

    Juh \'a sz , A., & Facchini , S. 2017, , 466, 4053, 10.1093/mnras/stw3389

    2017 doi

  55. [64]

    N., & Dullemond , C

    Kimmig , C. N., & Dullemond , C. P. 2024, , 689, A45, 10.1051/0004-6361/202348660

    2024 doi

  56. [65]

    N., & Villenave , M

    Kimmig , C. N., & Villenave , M. 2025, arXiv e-prints, arXiv:2504.05399, 10.48550/arXiv.2504.05399

    2025 doi arXiv

  57. [66]

    K., et al

    Kraus , S., Kreplin , A., Young , A. K., et al. 2020, Science, 369, 1233, 10.1126/science.aba4633

    2020 doi

  58. [67]

    S., & Haugb lle , T

    Kuffmeier , M., Jensen , S. S., & Haugb lle , T. 2023, European Physical Journal Plus, 138, 272, 10.1140/epjp/s13360-023-03880-y

    2023 doi

  59. [68]

    E., Segura-Cox , D., & Haugb lle , T

    Kuffmeier , M., Pineda , J. E., Segura-Cox , D., & Haugb lle , T. 2024, , 690, A297, 10.1051/0004-6361/202450410

    2024 doi

  60. [69]

    1999, , 524, 1030, 10.1086/307850

    Lai , D. 1999, , 524, 1030, 10.1086/307850

    1999 doi

  61. [70]

    P., Kluska , J., et al

    Lazareff , B., Berger , J. P., Kluska , J., et al. 2017, , 599, A85, 10.1051/0004-6361/201629305

    2017 doi

  62. [71]

    2013, , 433, 2157, 10.1093/mnras/stt878

    Lodato , G., & Facchini , S. 2013, , 433, 2157, 10.1093/mnras/stt878

    2013 doi

  63. [72]

    Lodato , G., & Price , D. J. 2010, , 405, 1212, 10.1111/j.1365-2966.2010.16526.x

    2010

  64. [73]

    Lodato , G., & Pringle , J. E. 2006, , 368, 1196, 10.1111/j.1365-2966.2006.10194.x

    2006

  65. [74]

    2007, , 381, 1287, 10.1111/j.1365-2966.2007.12332.x

    ---. 2007, , 381, 1287, 10.1111/j.1365-2966.2007.12332.x

    2007

  66. [75]

    2023, , 518, 4481, 10.1093/mnras/stac3223

    Lodato , G., Rampinelli , L., Viscardi , E., et al. 2023, , 518, 4481, 10.1093/mnras/stac3223

    2023 doi

  67. [76]

    2021, , 503, 4930, 10.1093/mnras/stab843

    Longarini , C., Lodato , G., Toci , C., & Aly , H. 2021, , 503, 4930, 10.1093/mnras/stab843

    2021 doi

  68. [77]

    2025, , 984, L17, 10.3847/2041-8213/adc431

    Longarini , C., Lodato , G., Rosotti , G., et al. 2025, , 984, L17, 10.3847/2041-8213/adc431

    2025 doi

  69. [78]

    A., \"O berg , K

    Loomis , R. A., \"O berg , K. I., Andrews , S. M., & MacGregor , M. A. 2017, , 840, 23, 10.3847/1538-4357/aa6c63

    2017 doi

  70. [79]

    A., Facchini , S., Benisty , M., et al

    Loomis , R. A., Facchini , S., Benisty , M., et al. 2025, , 984, L7, 10.3847/2041-8213/adc43a

    2025 doi

  71. [80]

    H., & Ogilvie , G

    Lubow , S. H., & Ogilvie , G. I. 2000, , 538, 326, 10.1086/309101

    2000 doi

  72. [81]

    F., Ansdell , M., Rosotti , G

    Manara , C. F., Ansdell , M., Rosotti , G. P., et al. 2023, in Astronomical Society of the Pacific Conference Series, Vol. 534, Protostars and Planets VII, ed. S. Inutsuka , Y. Aikawa , T. Muto , K. Tomida , & M. Tamura , 539, 10.48550/arXiv.2203.09930

    2023 doi arXiv

  73. [82]

    F., Testi , L., Natta , A., et al

    Manara , C. F., Testi , L., Natta , A., et al. 2014, , 568, A18, 10.1051/0004-6361/201323318

    2014 doi

  74. [83]

    F., Testi , L., Herczeg , G

    Manara , C. F., Testi , L., Herczeg , G. J., et al. 2017, , 604, A127, 10.1051/0004-6361/201630147

    2017 doi

  75. [84]

    2024, , 686, A9, 10.1051/0004-6361/202348546

    Martire , P., Longarini , C., Lodato , G., et al. 2024, , 686, A9, 10.1051/0004-6361/202348546

    2024 doi

  76. [85]

    2018, , 868, L3, 10.3847/2041-8213/aae88b

    Mayama , S., Akiyama , E., Pani \'c , O., et al. 2018, , 868, L3, 10.3847/2041-8213/aae88b

    2018 doi

  77. [86]

    E., Launhardt , R., et al

    M \"u ller , A., van den Ancker , M. E., Launhardt , R., et al. 2011, , 530, A85, 10.1051/0004-6361/201116732

    2011 doi

  78. [87]

    A., Benisty , M., Ginski , C., et al

    Muro-Arena , G. A., Benisty , M., Ginski , C., et al. 2020, , 635, A121, 10.1051/0004-6361/201936509

    2020 doi

  79. [88]

    G., & Nixon , C

    Nealon , R., Dipierro , G., Alexander , R., Martin , R. G., & Nixon , C. 2018, , 481, 20, 10.1093/mnras/sty2267

    2018 doi

  80. [89]

    2019, , 484, 4951, 10.1093/mnras/stz346

    Nealon , R., Pinte , C., Alexander , R., Mentiplay , D., & Dipierro , G. 2019, , 484, 4951, 10.1093/mnras/stz346

    2019 doi

  81. [90]

    J., & Pinte , C

    Nealon , R., Price , D. J., & Pinte , C. 2020, , 493, L143, 10.1093/mnrasl/slaa026

    2020 doi

  82. [91]

    2013, , 434, 1946, 10.1093/mnras/stt1136

    Nixon , C., King , A., & Price , D. 2013, , 434, 1946, 10.1093/mnras/stt1136

    2013 doi

  83. [92]

    Ogilvie , G. I. 1999, , 304, 557, 10.1046/j.1365-8711.1999.02340.x

    1999

  84. [93]

    I., & Latter , H

    Ogilvie , G. I., & Latter , H. N. 2013, , 433, 2403, 10.1093/mnras/stt916

    2013 doi

  85. [94]

    2025, arXiv e-prints, arXiv:2505.06044, 10.48550/arXiv.2505.06044

    Orihara , R., & Momose , M. 2025, arXiv e-prints, arXiv:2505.06044, 10.48550/arXiv.2505.06044

    2025 doi arXiv

  86. [95]

    2023, , 75, 424, 10.1093/pasj/psad009

    Orihara , R., Momose , M., Muto , T., et al. 2023, , 75, 424, 10.1093/pasj/psad009

    2023 doi

  87. [96]

    2005, , 358, 632, 10.1111/j.1365-2966.2005.08805.x

    O'Sullivan , M., Truss , M., Walker , C., et al. 2005, , 358, 632, 10.1111/j.1365-2966.2005.08805.x

    2005

  88. [97]

    Paardekooper , S.-J., & Ogilvie , G. I. 2019, , 483, 3738, 10.1093/mnras/sty3349

    2019 doi

  89. [98]

    Papaloizou , J. C. B., & Pringle , J. E. 1983, , 202, 1181, 10.1093/mnras/202.4.1181

    1983 doi

  90. [99]

    2011, Journal of Machine Learning Research, 12, 2825

    Pedregosa, F., Varoquaux, G., Gramfort, A., et al. 2011, Journal of Machine Learning Research, 12, 2825

    2011

  91. [100]

    M., Benisty , M., Andrews , S

    P \'e rez , L. M., Benisty , M., Andrews , S. M., et al. 2018, , 869, L50, 10.3847/2041-8213/aaf745

    2018 doi

  92. [101]

    E., Quanz , S

    Pineda , J. E., Quanz , S. P., Meru , F., et al. 2014, , 788, L34, 10.1088/2041-8205/788/2/L34

    2014 doi

  93. [102]

    2018, , 868, 85, 10.3847/1538-4357/aae824

    Pinilla , P., Benisty , M., de Boer , J., et al. 2018, , 868, 85, 10.3847/1538-4357/aae824

    2018 doi

  94. [103]

    J., M \'e nard , F., et al

    Pinte , C., Price , D. J., M \'e nard , F., et al. 2018, , 860, L13, 10.3847/2041-8213/aac6dc

    2018 doi

  95. [104]

    2020, , 890, L9, 10.3847/2041-8213/ab6dda

    ---. 2020, , 890, L9, 10.3847/2041-8213/ab6dda

    2020 doi

  96. [105]

    D., Huang , J., et al

    Pinte , C., Ilee , J. D., Huang , J., et al. 2025, , 984, L15, 10.3847/2041-8213/adc433

    2025 doi

  97. [106]

    J., Cuello , N., Pinte , C., et al

    Price , D. J., Cuello , N., Pinte , C., et al. 2018, , 477, 1270, 10.1093/mnras/sty647

    2018 doi

  98. [107]

    Pringle , J. E. 1996, , 281, 357, 10.1093/mnras/281.1.357

    1996 doi

  99. [108]

    B., Benisty , M., Ginski , C., et al

    Ren , B. B., Benisty , M., Ginski , C., et al. 2023, , 680, A114, 10.1051/0004-6361/202347353

    2023 doi

  100. [109]

    B., Xie , C., Benisty , M., et al

    Ren , B. B., Xie , C., Benisty , M., et al. 2024, , 681, L2, 10.1051/0004-6361/202348114

    2024 doi

  101. [110]

    2023, , 673, A77, 10.1051/0004-6361/202245637

    Ribas , \'A ., Mac \' as , E., Weber , P., et al. 2023, , 673, A77, 10.1051/0004-6361/202245637

    2023 doi

  102. [111]

    2015, , 801, 31, 10.1088/0004-637X/801/1/31

    Rigliaco , E., Pascucci , I., Duchene , G., et al. 2015, , 801, 31, 10.1088/0004-637X/801/1/31

    2015 doi

  103. [112]

    2024, arXiv e-prints, arXiv:2412.05650, 10.48550/arXiv.2412.05650

    Rogers , C., de Marchi , G., & Brandl , B. 2024, arXiv e-prints, arXiv:2412.05650, 10.48550/arXiv.2412.05650

    2024 doi arXiv

  104. [113]

    M., Koldoba , A

    Romanova , M. M., Koldoba , A. V., Ustyugova , G. V., et al. 2021, , 506, 372, 10.1093/mnras/stab1724

    2021 doi

  105. [114]

    A., Chiang , E., & Andrews , S

    Rosenfeld , K. A., Chiang , E., & Andrews , S. M. 2014, , 782, 62, 10.1088/0004-637X/782/2/62

    2014 doi

  106. [115]

    P., Dale , J

    Rosotti , G. P., Dale , J. E., de Juan Ovelar , M., et al. 2014, , 441, 2094, 10.1093/mnras/stu679

    2014 doi

  107. [116]

    2014, , 791, L38, 10.1088/2041-8205/791/2/L38

    Sakai , N., Oya , Y., Sakai , T., et al. 2014, , 791, L38, 10.1088/2041-8205/791/2/L38

    2014 doi

  108. [117]

    R., Henning , T., Christiaens , V., et al

    Schwarz , K. R., Henning , T., Christiaens , V., et al. 2024, , 962, 8, 10.3847/1538-4357/ad1393

    2024 doi

  109. [118]

    R., Samland , M., Olofsson , G., et al

    Schwarz , K. R., Samland , M., Olofsson , G., et al. 2025, , 980, 148, 10.3847/1538-4357/adaa79

    2025 doi

  110. [119]

    B., Dong , R., et al

    Shuai , L., Ren , B. B., Dong , R., et al. 2022, , 263, 31, 10.3847/1538-4365/ac98fd

    2022 doi

  111. [120]

    F., de Boer , J., et al

    Sicilia-Aguilar , A., Manara , C. F., de Boer , J., et al. 2020, , 633, A37, 10.1051/0004-6361/201936565

    2020 doi

  112. [121]

    L., Day , A

    Sitko , M. L., Day , A. N., Kimes , R. L., et al. 2012, , 745, 29, 10.1088/0004-637X/745/1/29

    2012 doi

  113. [122]

    2023, , 670, L1, 10.1051/0004-6361/202245381

    Stadler , J., Benisty , M., Izquierdo , A., et al. 2023, , 670, L1, 10.1051/0004-6361/202245381

    2023 doi

  114. [123]

    J., et al

    Stadler , J., Benisty , M., Winter , A. J., et al. 2025, , 984, L11, 10.3847/2041-8213/adb152

    2025 doi

  115. [124]

    M., McGinnis , P., et al

    Stauffer , J., Cody , A. M., McGinnis , P., et al. 2015, , 149, 130, 10.1088/0004-6256/149/4/130

    2015 doi

  116. [125]

    C., & Gahm , G

    Stempels , H. C., & Gahm , G. F. 2004, , 421, 1159, 10.1051/0004-6361:20034502

    2004 doi

  117. [126]

    2016, , 595, A113, 10.1051/0004-6361/201528039

    Stolker , T., Dominik , C., Avenhaus , H., et al. 2016, , 595, A113, 10.1051/0004-6361/201528039

    2016 doi

  118. [127]

    M., et al

    Teague , R., Bae , J., Andrews , S. M., et al. 2022, , 936, 163, 10.3847/1538-4357/ac88ca

    2022 doi

  119. [128]

    2025, , 984, L6, 10.3847/2041-8213/adc43b

    Teague , R., Benisty , M., Facchini , S., et al. 2025, , 984, L6, 10.3847/2041-8213/adc43b

    2025 doi

  120. [129]

    2024, arXiv e-prints, arXiv:2405.15944, 10.48550/arXiv.2405.15944

    Veronesi , B., Longarini , C., Lodato , G., et al. 2024, arXiv e-prints, arXiv:2405.15944, 10.48550/arXiv.2405.15944

    2024 doi arXiv

  121. [130]

    2023, , 946, 70, 10.3847/1538-4357/acb92e

    Villenave , M., Podio , L., Duch \^e ne , G., et al. 2023, , 946, 70, 10.3847/1538-4357/acb92e

    2023 doi

  122. [131]

    M., & Stapelfeldt , K

    Watson , A. M., & Stapelfeldt , K. R. 2007, , 133, 845, 10.1086/510455

    2007 doi

  123. [132]

    J., Benisty , M., Manara , C

    Winter , A. J., Benisty , M., Manara , C. F., & Gupta , A. 2024 a , , 691, A169, 10.1051/0004-6361/202452120

    2024 doi

  124. [133]

    J., Benisty , M., Shuai , L., et al

    Winter , A. J., Benisty , M., Shuai , L., et al. 2024 b , , 691, A43, 10.1051/0004-6361/202450842

    2024 doi

  125. [134]

    2025, , 984, L22, 10.3847/2041-8213/adc42c

    W \"o lfer , L., Barraza-Alfaro , M., Teague , R., et al. 2025, , 984, L22, 10.3847/2041-8213/adc42c

    2025 doi

  126. [135]

    K., Alexander , R., Rosotti , G., & Pinte , C

    Young , A. K., Alexander , R., Rosotti , G., & Pinte , C. 2022, , 513, 487, 10.1093/mnras/stac840

    2022 doi

  127. [136]

    K., Alexander , R., Walsh , C., et al

    Young , A. K., Alexander , R., Walsh , C., et al. 2021, , 505, 4821, 10.1093/mnras/stab1675

    2021 doi

  128. [137]

    K., Stevenson , S., Nixon , C

    Young , A. K., Stevenson , S., Nixon , C. J., & Rice , K. 2023, , 525, 2616, 10.1093/mnras/stad2451

    2023 doi

  129. [138]

    2025, arXiv e-prints, arXiv:2506.16481, 10.48550/arXiv.2506.16481

    Zagaria , F., Jiang , H., Cataldi , G., et al. 2025, arXiv e-prints, arXiv:2506.16481, 10.48550/arXiv.2506.16481

    2025 doi arXiv

  130. [139]

    2025, , 984, L14, 10.3847/2041-8213/adc434

    Zawadzki , B., Czekala , I., Galloway-Sprietsma , M., et al. 2025, , 984, L14, 10.3847/2041-8213/adc434

    2025 doi

  131. [140]

    2024, , 974, L38, 10.3847/2041-8213/ad815f

    Zhang , S., & Zhu , Z. 2024, , 974, L38, 10.3847/2041-8213/ad815f

    2024 doi

  132. [141]

    B., Ma , B., et al

    Zhong , H., Ren , B. B., Ma , B., et al. 2024, , 684, A168, 10.1051/0004-6361/202348874

    2024 doi

  133. [142]

    2019, , 483, 4221, 10.1093/mnras/sty3358

    Zhu , Z. 2019, , 483, 4221, 10.1093/mnras/sty3358

    2019 doi

  134. [143]

    P., Birnstiel , T., Benisty , M., & Nelson , R

    Ziampras , A., Dullemond , C. P., Birnstiel , T., Benisty , M., & Nelson , R. P. 2025, , 540, 1185, 10.1093/mnras/staf785

    2025 doi

  135. [144]

    2024, , 692, A56, 10.1051/0004-6361/202451145

    Zuleta , A., Birnstiel , T., & Teague , R. 2024, , 692, A56, 10.1051/0004-6361/202451145

    2024 doi

Pith tools

Reviewed August 6, 2026 · model on record in the stance chip above.