Pith. sign in

REVIEW 3 major objections 2 minor 1 cited by

Breakable Machine: A K-12 Classroom Game for Transformative AI Literacy Through Spoofing and eXplainable AI (XAI)

T0 review · 3 major / 2 minor · reviewed 2026-08-05 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read A classroom game claims that deliberately breaking an image classifier builds transformative AI literacy in students aged 10-15.

desk verdict The record is broken: the full text is a condensed-matter physics paper, so I can only review the abstract; the game design is promising but the learning-outcome claims are unsupported. read the letter →

arxiv 2508.14201 v1 pith:7RPG4K47 submitted 2025-08-19 cs.CY

Olli Hilke , Nicolas Pope , Juho Kahila , Henriikka Vartiainen , Teemu Roos , Tuomo Parkki , Matti Tedre This is my paper
classification cs.CY
keywords AIliteracyK-12educationexplainable(XAI)adversarialplayimageclassifierspoofingdataagencysociotechnicalsystemseducationalgame
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper introduces Breakable Machine, a classroom game for learners aged 10-15 that replaces model-building with model-breaking. Students manipulate their appearance or environment to trick an image classifier into confident misclassifications, and an explainable-AI view lets them see which visual cues the model attends to. A shared leaderboard turns individual exploits into collective inquiry. The authors' claim is that this adversarial, embodied play develops data agency, ethical awareness, and a critical stance toward AI systems, treating failures not as bugs but as windows into AI as a sociotechnical system.

What carries the argument

Three coupled mechanisms carry the argument: an embodied spoofing task, in which students alter their appearance or surroundings to trigger high-confidence misclassifications; an eXplainable AI (XAI) saliency view that highlights which visual features the model attends to; and a shared classroom leaderboard that turns individual strategies into collective comparison and sensemaking. Together they reframe model failure as a learning resource rather than a problem to be debugged.

What would settle it

Run the game in classrooms with pre/post measures of students' ability to explain why a classifier misfires and their willingness to question AI outputs; if scores do not move relative to a control group, the central claim fails. Separately, validate the XAI view by comparing saliency maps against occlusion or input perturbation: if highlighted regions do not correspond to features whose removal changes predictions, the view is teaching false lessons.

Watch

Extended reading notes

Core claim

The central claim is that misclassification can be a productive pedagogical event. By inviting students to deliberately spoof a classifier and then inspect saliency maps, the game converts hidden model behavior into observable, discussable phenomena. The authors argue that this supports transformative AI literacy: not just knowing how AI works, but questioning its brittleness, bias, and embeddedness in everyday life. The game and its source code are freely available.

Load-bearing premise

The claim rests on two unshown premises: that the game's evaluation actually measures data agency, ethical awareness, and critical stance in 10-15 year olds, and that the saliency visualizations teach accurate intuitions about the model rather than misleading ones.

Editorial extensions

If this is right

  • If the central claim is correct, breaking rather than building AI becomes a viable K-12 pedagogy for critical AI literacy.
  • Children can use saliency visualizations as evidence to compare spoofing strategies and reason about which cues the model relies on.
  • A leaderboard-driven classroom turns misclassification into shared inquiry, potentially supporting collaborative sensemaking about AI systems.
  • Adversarial, embodied play may cultivate data agency and ethical awareness in learners who would not otherwise engage with technical AI concepts.
  • Free availability of the game and source code makes the approach directly testable and adaptable in other classrooms.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • A testable extension would compare this spoofing-based game against a conventional model-building curriculum using validated pre/post measures of students' ability to explain AI misclassifications and their willingness to question AI outputs.
  • The game's pedagogical value may depend on the XAI view being truthful: saliency maps are known to be unstable, so an occlusion-based or perturbation-based attribution overlay might teach more accurate intuitions and is a concrete design variant worth testing.
  • The attached full text does not contain this paper's study; it is an unrelated condensed-matter manuscript, so the learning-outcome claims rest on the abstract alone and currently lack visible evaluation details.
  • If the approach is effective, a natural next step is to extend it beyond image classifiers to other everyday AI systems, such as recommender or language models, where the 'materials' students spoof are texts or choices rather than appearance.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 2 minor

Summary. As represented by the abstract, this paper proposes "Breakable Machine," a classroom game for learners aged 10–15 in which students deliberately cause high-confidence misclassifications in an image classifier, inspect feature-saliency visualizations, and compare strategies on a shared leaderboard. The abstract claims that this adversarial, XAI-centered activity promotes data agency, ethical awareness, and a critical stance toward AI, and states that the game and source code are freely available. However, the full text supplied under arXiv:2508.14201 is not this paper: it is a condensed-matter physics manuscript on the electronic properties of EuZn2As2 and EuCd2Sb2 (arXiv:2508.14205). No game description, technical implementation, classroom procedure, evaluation, sample, outcome measure, or comparison condition appears anywhere in the provided full text. The central claims of the abstract are therefore uncheckable in the manuscript under review.

Significance. If the actual Breakable Machine paper exists with a rigorous evaluation, the idea is potentially valuable for K-12 AI literacy: it reframes model errors as pedagogical opportunities, introduces XAI saliency to children, and makes a concrete artifact freely available. The open-source commitment is a strength. But the submission as provided does not permit assessment of the game's design, feasibility, or effectiveness. The learning-outcome claims—data agency, ethical awareness, critical stance—are stated without evidence, and the XAI saliency assumption (that the maps are accurate and comprehensible to children) is load-bearing and unsupported. As it stands, the manuscript cannot be scientifically evaluated.

major comments (3)
  1. [Full Text (entire manuscript body)] The supplied full text is a different document: a condensed-matter physics paper on EuZn2As2 and EuCd2Sb2, arXiv:2508.14205. It contains no mention of Breakable Machine, K-12 education, image classifiers, spoofing, XAI, leaderboards, or any evaluation. This is a load-bearing inconsistency: the central artifact and all its supporting details are absent, so the abstract's claims cannot be checked against any methods, figures, or data.
  2. [Abstract, learning-outcome claim] The abstract states the game "supports students in developing data agency, ethical awareness, and a critical stance toward AI systems," but no evidence is provided: no sample, no instrument, no baseline or comparison condition, no pre/post measures, no classroom observation, and no analysis. Even for a resource paper, a design rationale or pilot data would be needed to support these specific competency claims. As submitted, the claim is an assertion, not a demonstrated result.
  3. [Abstract, XAI saliency view] The game's pedagogical mechanism relies on an XAI view that "reveals how models attend to specific visual cues." The submission gives no technical details of the saliency method and no evidence that the visualizations are faithful to the model's behavior or interpretable by children aged 10–15. Given the known instability of saliency maps in the machine-learning literature, this premise needs either a citation to a validated approach for this age group or empirical demonstration. Without it, the central teaching mechanism is unsupported.
minor comments (2)
  1. [Abstract] The term XAI is expanded in the title but not defined in the abstract; a brief expansion would help readers unfamiliar with the acronym.
  2. [General] The discrepancy between the abstract and the full text should be resolved before any further review. If this is a packaging error, the correct manuscript must be supplied.

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity identified: the abstract claims an outcome, but no derivation chain or fitted input is present that would reduce the claim to its own premises.

full rationale

The available material for arXiv:2508.14201 is the abstract; the supplied full text is actually arXiv:2508.14205, a condensed-matter paper on EuZn2As2 and EuCd2Sb2, not the Breakable Machine game paper. The abstract describes a designed artifact and asserts that adversarial play with an XAI view 'supports students in developing data agency, ethical awareness, and a critical stance.' That is an empirical outcome claim that would need an external instrument and comparison; it is not a derivation from, or a reduction to, the game's own design parameters. No equation, fitted parameter, uniqueness theorem, or self-citation chain appears. The XAI view is described as a pedagogical feature, not as a measured proxy for the outcome, and the leaderboard is a mechanism, not a definition of data agency. Because no step can be exhibited where a 'prediction' equals an input by construction, the circularity score is 0. Lack of evaluation evidence is a completeness or validity concern, not circularity.

Assumptions & free parameters 2 free parameters · 3 assumptions · 0 invented entities

The central learning-outcome claim rests on three domain assumptions: that children acquire transferable critical AI literacy from adversarial play, that saliency visualizations are truthful and interpretable for the age group, and that the evaluation, if any, measures the stated outcomes. Design parameters such as the high-confidence misclassification threshold and the leaderboard scoring rule are chosen by hand, but their values are not reported in the abstract. No empirically fitted parameters or invented entities are in evidence at the abstract level.

free parameters (2)
  • High-confidence misclassification threshold
    The game's central mechanic is triggering high-confidence misclassifications; the confidence cutoff is a hand-chosen design parameter and the abstract does not report its value.
  • Leaderboard scoring rule
    The shared classroom leaderboard is a core mechanic; its scoring and ranking rules are design choices not described in the abstract.
assumptions (3)
  • domain assumption Learners aged 10 to 15 can meaningfully engage with adversarial spoofing and derive critical AI literacy from it.
    The entire pedagogical claim presupposes this; the abstract asserts it without citing evidence.
  • domain assumption XAI saliency visualizations reveal how the model attends to visual cues in a way that is accurate and interpretable to children.
    Saliency maps are known to be unstable and sometimes misleading in the ML literature; the game's pedagogical mechanism depends on them being truthful and comprehensible for the target age group.
  • domain assumption Treating model failure as a pedagogically rich opportunity yields transformative AI literacy, data agency, and ethical awareness.
    This is the framing premise of the design, asserted in the abstract without an empirical demonstration.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Breakable Machine: A K-12 Classroom Game for Transformative AI Literacy Through Spoofing and eXplainable AI (XAI)." pith.science (2026). https://pith.science/paper/7RPG4K47

@misc{pith2026250814201,
  author       = {Pith},
  title        = {Pith review of: Breakable Machine: A K-12 Classroom Game for Transformative AI Literacy Through Spoofing and eXplainable AI (XAI)},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/7RPG4K47}},
  note         = {Machine review of arXiv:2508.14201}
}
read the original abstract

This paper, submitted to the special track on resources for teaching AI in K-12, presents an eXplainable AI (XAI)-based classroom game "Breakable Machine" for teaching critical, transformative AI literacy through adversarial play and interrogation of AI systems. Designed for learners aged 10-15, the game invites students to spoof an image classifier by manipulating their appearance or environment in order to trigger high-confidence misclassifications. Rather than focusing on building AI models, this activity centers on breaking them-exposing their brittleness, bias, and vulnerability through hands-on, embodied experimentation. The game includes an XAI view to help students visualize feature saliency, revealing how models attend to specific visual cues. A shared classroom leaderboard fosters collaborative inquiry and comparison of strategies, turning the classroom into a site for collective sensemaking. This approach reframes AI education by treating model failure and misclassification not as problems to be debugged, but as pedagogically rich opportunities to interrogate AI as a sociotechnical system. In doing so, the game supports students in developing data agency, ethical awareness, and a critical stance toward AI systems increasingly embedded in everyday life. The game and its source code are freely available.

Discussion (0). Sign in to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. "GenAI Defaults to Bias!" Gamify AI Literacy Through Reflections on Prompts

    cs.HC 2025-09 conditional novelty 5.0 of 10

    Playing ImaginAItion, a prompt-minimization party game, helped 30 adults recognize GenAI default biases and adjust their prompting strategies, according to pre-post survey coding.

Reference graph

Works this paper leans on

61 extracted references · 56 canonical work pages · cited by 1 Pith paper

  1. [12]

    Y. Xu, Z. Song, Z. Wang, H. Weng, and X. Dai, Higher-order topology of the axion insulator EuIn 2As2, Phys. Rev. Lett. 122, 256402 (2019)

    work page 2019

  2. [13]

    T. Sato, Z. Wang, D. Takane, S. Souma, C. Cui, Y. Li, K. Nakayama, T. Kawakami, Y. Kub- ota, C. Cacho, T. K. Kim, A. Arab, V. N. Strocov, Y. Yao, and T. Takahashi, Signature of band inversion in the antiferromagnetic phase of axion insulator candidate EuIn 2As2, Phys. Rev. Res. 2, 033342 (2020)

    work page 2020

  3. [14]

    S. X. Riberolles, T. V. Trevisan, B. Kuthanazhi, T. W. Heitmann, F. Ye, D. C. Johnston, S. L. Bud’ko, D. H. Ryan, P. C. Canfield, A. Kreyssig, A. Vishwanath, R. J. McQueeney, L. L. Wang, P. P. Orth, and B. G. Ueland, Magnetic crystalline-symmetry-protected axion electrodynamics and field-tunable unpinned dirac cones in EuIn 2As2, Nature Communications 12,...

    work page 2021

  4. [15]

    M. Gong, D. Sar, J. Friedman, D. Kaczorowski, S. Abdel Razek, W.-C. Lee, and P. Aynajian, Surface state evolution induced by magnetic order in axion insulator candidate EuIn 2As2, Phys. Rev. B 106, 125156 (2022)

    work page 2022

  5. [16]

    A. M. Goforth, P. Klavins, J. C. Fettinger, and S. M. Kauzlarich, Magnetic properties and neg- ative colossal magnetoresistance of the rare earth zintl phase EuIn 2As2, Inorganic Chemistry 47, 11048 (2008)

    work page 2008

  6. [17]

    Y. Wang, C. Li, T. Miao, S. Zhang, Y. Li, L. Zhou, M. Yang, C. Yin, Y. Cai, C. Song, H. Luo, H. Chen, H. Mao, L. Zhao, H. Deng, Y. Sun, C. Zhu, F. Zhang, F. Yang, Z. Wang, S. Zhang, Q. Peng, S. Pan, Y. Shi, H. Weng, T. Xiang, Z. Xu, and X. J. Zhou, Giant and reversible electronic structure evolution in a magnetic topological material EuCd 2As2, Phys. Rev....

    work page 2022

  7. [18]

    K. M. Taddei, L. Yin, L. D. Sanjeewa, Y. Li, J. Xing, C. dela Cruz, D. Phelan, A. S. Sefat, and D. S. Parker, Single pair of weyl nodes in the spin-canted structure of EuCd 2As2, Phys. Rev. B 105, L140401 (2022)

    work page 2022

  8. [19]

    J.-R. Soh, F. de Juan, M. G. Vergniory, N. B. M. Schr¨ oter, M. C. Rahn, D. Y. Yan, J. Jiang, M. Bristow, P. Reiss, J. N. Blandy, Y. F. Guo, Y. G. Shi, T. K. Kim, A. McCollam, S. H. Simon, Y. Chen, A. I. Coldea, and A. T. Boothroyd, Ideal weyl semimetal induced by magnetic exchange, Phys. Rev. B 100, 201102 (2019)

    work page 2019

Show all 61 references
  1. [20]

    N. H. Jo, B. Kuthanazhi, Y. Wu, E. Timmons, T.-H. Kim, L. Zhou, L.-L. Wang, B. G. Ueland, A. Palasyuk, D. H. Ryan, R. J. McQueeney, K. Lee, B. Schrunk, A. A. Burkov, R. Prozorov, S. L. Bud’ko, A. Kaminski, and P. C. Canfield, Manipulating magnetism in the topological 15 semime...

    2020

  2. [21]

    H. Su, B. Gong, W. Shi, H. Yang, H. Wang, W. Xia, Z. Yu, P.-J. Guo, J. Wang, L. Ding, L. Xu, X. Li, X. Wang, Z. Zou, N. Yu, Z. Zhu, Y. Chen, Z. Liu, K. Liu, G. Li, and Y. Guo, Magnetic exchange induced weyl state in a semimetal EuCd 2Sb2, APL Materials 8, 011109 (2020), https:...

    2020 doi

  3. [22]

    E. Gati, S. L. Bud’ko, L.-L. Wang, A. Valadkhani, R. Gupta, B. Kuthanazhi, L. Xiang, J. M. Wilde, A. Sapkota, Z. Guguchia, R. Khasanov, R. Valent ´ ı, and P. C. Canfield, Pressure- induced ferromagnetism in the topological semimetal EuCd 2As2, Phys. Rev. B 104, 155124 (2021)

    2021

  4. [23]

    Y. Xu, L. Das, J. Z. Ma, C. J. Yi, S. M. Nie, Y. G. Shi, A. Tiwari, S. S. Tsirkin, T. Neupert, M. Medarde, M. Shi, J. Chang, and T. Shang, Unconventional transverse transport above and below the magnetic transition temperature in weyl semimetal EuCd 2As2, Phys. Rev. Lett. 126,...

    2021

  5. [24]

    Blawat, M

    J. Blawat, M. Marshall, J. Singleton, E. Feng, H. Cao, W. Xie, and R. Jin, Unusual electrical and magnetic properties in layered EuZn 2As2, Advanced Quantum Technologies 5, 2200012 (2022), https://advanced.onlinelibrary.wiley.com/doi/pdf/10.1002/qute.202200012

    2022 doi

  6. [25]

    M. Ohno, S. Minami, Y. Nakazawa, S. Sato, M. Kriener, R. Arita, M. Kawasaki, and M. Uchida, Maximizing intrinsic anomalous hall effect by controlling the fermi level in simple weyl semimetal films, Phys. Rev. B 105, L201101 (2022)

    2022

  7. [26]

    Blawat, S

    J. Blawat, S. Speer, J. Singleton, W. Xie, and R. Jin, Quantum-limit phenomena and band structure in the magnetic topological semimetal EuZn 2As2, Communications Physics 6, 255 (2023)

    2023

  8. [27]

    Z. Yu, X. Chen, W. Xia, N. Wang, X. Lv, D. Wu, W. Wu, Z. Liu, J. Zhao, M. Li, S. Li, X. Li, Z. Dong, C. Zhou, L. Zhang, X. Wang, N. Yu, Z. Zou, J. Luo, J. Cheng, L. Wang, Z. Zhong, and Y. Guo, Structure, magnetotransport, and theoretical study on the layered antiferromagnet to...

    2023 doi

  9. [28]

    Z.-C. Wang, E. Been, J. Gaudet, G. M. A. Alqasseri, K. Fruhling, X. Yao, U. Stuhr, Q. Zhu, Z. Ren, Y. Cui, C. Jia, B. Moritz, S. Chowdhury, T. Devereaux, and F. Tafti, Anisotropy of the magnetic and transport properties of EuZn 2As2, Phys. Rev. B 105, 165122 (2022). 16

    2022

  10. [29]

    Chen, Z.-F

    H.-C. Chen, Z.-F. Lou, Y.-X. Zhou, Q. Chen, B.-J. Xu, S.-J. Chen, J.-H. Du, J.-H. Yang, H.-D. Wang, and M.-H. Fang, Negative magnetoresistance in antiferromagnetic topological insulator EuSn2As2, Chin. Phys. Lett. 37, 047201 (2020)

    2020

  11. [30]

    S. Luo, Y. Xu, F. Du, L. Yang, Y. Chen, C. Cao, Y. Song, and H. Yuan, Colossal magnetore- sistance and topological phase transition in EuZn 2As2, Phys. Rev. B 108, 205140 (2023)

    2023

  12. [31]

    K. S. Pervakov, A. V. Sadakov, O. A. Sobolevskiy, V. A. Vlasenko, V. P. Martovitsky, E. A. Sedov, E. I. Maltsev, N. Perez, L. Veyrat, P. D. Grigoriev, N. S. Pavlov, I. A. Nekrasov, O. E. Tereshchenko, V. A. Golyashov, and V. M. Pudalov, Intrinsic negative magnetoresistance in ...

    2024 arXiv

  13. [32]

    Y.-F. Li, E. M. Been, S. Balguri, C.-J. Jia, M. B. Mahendru, Z.-C. Wang, Y. Cui, S.-D. Chen, M. Hashimoto, D.-H. Lu, B. Moritz, J. Zaanen, F. Tafti, T. P. Dev- ereaux, and Z.-X. Shen, Colossal magnetoresistance from spin-polarized polarons in an ising system, Proceedings of th...

    2024 doi

  14. [33]

    Balguri, M

    S. Balguri, M. B. Mahendru, E. O. G. Delgado, K. Fruhling, X. Yao, D. E. Graf, J. A. Rodriguez-Rivera, A. A. Aczel, T. J. Hicken, H. Luetkens, M. J. Graf, A. Rydh, J. Gaudet, and F. Tafti, Two types of colossal magnetoresistance with distinct mechanisms inEu5In 2As6, Phys. Rev...

    2025

  15. [34]

    Pohlit, S

    M. Pohlit, S. R¨ oßler, Y. Ohno, H. Ohno, S. von Moln´ ar, Z. Fisk, J. M¨ uller, and S. Wirth, Evidence for ferromagnetic clusters in the colossal-magnetoresistance material EuB6, Phys. Rev. Lett. 120, 257201 (2018)

    2018

  16. [35]

    M. J. Calder´ on, L. G. L. Wegener, and P. B. Littlewood, Evaluation of evidence for magnetic polarons in EuB6, Phys. Rev. B 70, 092408 (2004)

    2004

  17. [36]

    M. V. A. Crivillero, S. R¨ oßler, S. Granovsky, M. Doerr, M. S. Cook, P. F. Rosa, J. M¨ uller, and S. Wirth, Magnetic and electronic properties unveil polaron formation in Eu5In 2Sb6, Scientific Reports 13, 1597 (2023)

    2023

  18. [37]

    J. C. Souza, S. M. Thomas, E. D. Bauer, J. D. Thompson, F. Ronning, P. G. Pagliuso, and P. F. S. Rosa, Microscopic probe of magnetic polarons in antiferromagnetic Eu5In 2Sb6, Phys. Rev. B 105, 035135 (2022)

    2022

  19. [38]

    M. S. Cook, E. A. Peterson, C. S. Kengle, E. R. Kennedy, J. Sheeran, C. Girod, G. S. Freitas, S. M. Greer, P. Abbamonte, P. G. Pagliuso, J. D. Thompson, S. M. Thomas, and P. F. S. 17 Rosa, Magnetic polaron formation in EuZn 2P2, (2025), arXiv:2504.05494

    2025 arXiv

  20. [39]

    M. Kopp, C. Garg, S. Krebber, K. Kliemt, C. Krellner, S. Balguri, M. Mahendru, F. Tafti, T. L. Breeze, N. P. Bentley, F. L. Pratt, T. J. Hicken, H. Luetkens, J. A. Krieger, S. J. Blundell, T. Lancaster, M. V. A. Crivillero, S. Wirth, and J. M¨ uller, Robust magnetic polaron pe...

    2025 arXiv

  21. [40]

    X. Lv, X. Chen, B. Zhang, P. Jiang, and Z. Zhong, Thickness-dependent magnetism and topological properties of EuSn 2As2, ACS Applied Electronic Materials 4, 3212 (2022)

    2022

  22. [41]

    A. B. Sarkar, S. Mardanya, S.-M. Huang, B. Ghosh, C.-Y. Huang, H. Lin, A. Bansil, T.-R. Chang, A. Agarwal, and B. Singh, Magnetically tunable dirac and weyl fermions in the zintl materials family, Phys. Rev. Mater. 6, 044204 (2022)

    2022

  23. [42]

    E. Yi, D. F. Zheng, F. Pan, H. Zhang, B. Wang, B. Chen, D. Wu, H. Liang, Z. X. Mei, H. Wu, S. A. Yang, P. Cheng, M. Wang, and B. Shen, Topological hall effect driven by short-range magnetic order in EuZn 2As2, Phys. Rev. B 107, 035142 (2023)

    2023

  24. [43]

    Zhang, K

    Y. Zhang, K. Deng, X. Zhang, M. Wang, Y. Wang, C. Liu, J.-W. Mei, S. Kumar, E. F. Schwier, K. Shimada, C. Chen, and B. Shen, In-plane antiferromagnetic moments and magnetic polaron in the axion topological insulator candidate EuIn 2As2, Phys. Rev. B 101, 205126 (2020)

    2020

  25. [44]

    F. H. Yu, H. M. Mu, W. Z. Zhuo, Z. Y. Wang, Z. F. Wang, J. J. Ying, and X. H. Chen, Elevating the magnetic exchange coupling in the compressed antiferromagnetic axion insulator candidate EuIn 2As2, Phys. Rev. B 102, 180404 (2020)

    2020

  26. [45]

    Regmi, M

    S. Regmi, M. M. Hosen, B. Ghosh, B. Singh, G. Dhakal, C. Sims, B. Wang, F. Kabir, K. Dim- itri, Y. Liu, A. Agarwal, H. Lin, D. Kaczorowski, A. Bansil, and M. Neupane, Temperature- dependent electronic structure in a higher-order topological insulator candidate EuIn 2As2, Phys....

    2020

  27. [46]

    H. Li, W. Gao, Z. Chen, W. Chu, Y. Nie, S. Ma, Y. Han, M. Wu, T. Li, Q. Niu, W. Ning, X. Zhu, and M. Tian, Magnetic properties of the layered magnetic topological insulator EuSn 2As2, Phys. Rev. B 104, 054435 (2021)

    2021

  28. [47]

    L. Zhao, C. Yi, C.-T. Wang, Z. Chi, Y. Yin, X. Ma, J. Dai, P. Yang, B. Yue, J. Cheng, F. Hong, J.-T. Wang, Y. Han, Y. Shi, and X. Yu, MonoclinicEuSn 2As2: A novel high-pressure network structure, Phys. Rev. Lett. 126, 155701 (2021)

    2021

  29. [48]

    Shinozaki, Y

    K. Shinozaki, Y. Goto, K. Hoshi, R. Kiyama, N. Nakamura, A. Miura, C. Moriyoshi, Y. Kuroiwa, H. Usui, and Y. Mizuguchi, Thermoelectric properties of the As/P-based zintl 18 compounds EuIn 2As2 − xPx (x=0-2) and SrSn 2As2, ACS Applied Energy Materials 4, 5155 (2021)

    2021

  30. [49]

    J. Yan, Z. Z. Jiang, R. C. Xiao, W. J. Lu, W. H. Song, X. B. Zhu, X. Luo, Y. P. Sun, and M. Yamashita, Field-induced topological hall effect in antiferromagnetic axion insulator candidate EuIn 2As2, Phys. Rev. Res. 4, 013163 (2022)

    2022

  31. [50]

    Cao, J.-X

    X. Cao, J.-X. Yu, P. Leng, C. Yi, X. Chen, Y. Yang, S. Liu, L. Kong, Z. Li, X. Dong, Y. Shi, M. Bibes, R. Peng, J. Zang, and F. Xiu, Giant nonlinear anomalous hall effect induced by spin-dependent band structure evolution, Phys. Rev. Res. 4, 023100 (2022)

    2022

  32. [51]

    J.-Z. Ma, S. M. Nie, C. J. Yi, J. Jandke, T. Shang, M. Y. Yao, M. Naamneh, L. Q. Yan, Y. Sun, A. Chikina, V. N. Strocov, M. Medarde, M. Song, Y.-M. Xiong, G. Xu, W. Wulfhekel, J. Mesot, M. Reticcioli, C. Franchini, C. Mudry, M. M¨ uller, Y. G. Shi, T. Qian, H. Ding, and M. Shi...

    2019 doi

  33. [52]

    Nishihaya, A

    S. Nishihaya, A. Nakamura, M. Ohno, M. Kriener, Y. Watanabe, M. Kawasaki, and M. Uchida, Intrinsic insulating transport characteristics in low-carrier density EuCd 2As2 films, Applied Physics Letters 124, 023103 (2024), https://pubs.aip.org/aip/apl/article- pdf/doi/10.1063/5.0...

    2024 doi

  34. [53]

    R. A. Nelson, J. King, S. Cheng, A. J. Williams, C. Jozwiak, A. Bostwick, E. Rotenberg, S. Sasmal, I. H. Kao, A. Tiwari, N. R. Jones, C. Cai, E. Martin, A. Dolocan, L. Shi, R. K. Kawakami, J. P. Heremans, J. Katoch, and J. E. Goldberger, Revealing the EuCd 2As2 semi- conductin...

    2024

  35. [54]

    Santos-Cottin, I

    D. Santos-Cottin, I. Mohelsk´ y, J. Wyzula, F. Le Mardel´ e, I. Kapon, S. Nasrallah, N. Bariˇ si´ c, I. ˇZivkovi´ c, J. R. Soh, F. Guo, K. Rigaux, M. Puppin, J. H. Dil, B. Gudac, Z. Rukelj, M. Novak, A. B. Kuzmenko, C. C. Homes, T. Dietl, M. Orlita, and A. Akrap, EuCd 2As2: A ...

    2023

  36. [55]

    Nasrallah, D

    S. Nasrallah, D. Santos-Cottin, F. Le Mardel´ e, I. Mohelsk´ y, J. Wyzula, L. Akˇ samovi´ c, P. Saˇ cer, J. W. H. Barrett, W. Galloway, K. Rigaux, F. Guo, M. Puppin, I.ˇZivkovi´ c, J. H. Dil, M. Novak, C. C. Homes, M. Orlita, N. Bariˇ si´ c, and A. Akrap, Magneto-optical respo...

    2024

  37. [56]

    D. Kong, S. Karbasizadeh, G. Narasimha, P. Regmi, C. Tao, S. Mu, R. Vasudevan, I. Harrison, R. Jin, and Z. Gai, Large bandgap observed on the surfaces of EuZn 2As2 single crystals, 19 (2024), arXiv:2408.08858

    2024 arXiv

  38. [57]

    V. W. Brar, R. Decker, H. M. Solowan, Y. Wang, L. Maserati, K. T. Chan, H. Lee, C ¸ aˇ glar O. Girit, A. Zettl, S. G. Louie, M. L. Cohen, and M. F. Crommie, Gate-controlled ionization and screening of cobalt adatoms on a graphene surface, Nature Physics 7, 43 (2011)

    2011

  39. [58]

    D. H. Lee and J. A. Gupta, Tunable control over the ionization state of single Mn acceptors in GaAs with defect-induced band bending, Nano Letters 11, 2004 (2011)

    2004

  40. [59]

    Di Bernardo, J

    I. Di Bernardo, J. Blyth, L. Watson, K. Xing, Y.-H. Chen, S.-Y. Chen, M. T. Edmonds, and M. S. Fuhrer, Defects, band bending and ionization rings in M oS2, Journal of Physics: Condensed Matter 34, 174002 (2022)

    2022

  41. [60]

    Le Quang, K

    T. Le Quang, K. Nogajewski, M. Potemski, M. T. Dau, M. Jamet, P. Mallet, and J.-Y. Veuillen, Band-bending induced by charged defects and edges of atomically thin transition metal dichalcogenide films, 2D Materials 5, 035034 (2018)

    2018

  42. [61]

    Morgenstern, V

    M. Morgenstern, V. Gudmundsson, R. Dombrowski, C. Wittneven, and R. Wiesendanger, Nonlocality of the exchange interaction probed by scanning tunneling spectroscopy, Phys. Rev. B 63, 201301 (2001)

    2001

  43. [62]

    Zhang, L

    J. Zhang, L. Song, and B. B. Iversen, Insights into the design of thermoelectric M g3Sb2 and its analogs by combining theory and experiment, npj Computational Materials 5, 76 (2019)

    2019

  44. [63]

    A. C. Durst, A. C. Durst, R. N. Bhatt, and P. A. Wolff, Bound magnetic polaron interactions in insulating doped diluted magnetic semiconductors, Physical Review B - Condensed Matter and Materials Physics 65, 2352051 (2002)

    2002

  45. [64]

    Jiang, W

    Y. Jiang, W. Yan, Z. Sun, Q. Liu, Z. Pan, T. Yao, Y. Li, Z. Qi, G. Zhang, P. Xu, Z. Wu, and S. Wei, Experimental and theoretical investigations on ferromagnetic nature of Mn-doped dilute magnetic semiconductors, Journal of Physics: Conference Series 190, 012100 (2009)

    2009

  46. [65]

    Shon, J.-S

    W. Shon, J.-S. Rhyee, Y. Jin, and S.-J. Kim, Magnetic polaron and unconventional magneto- transport properties of the single-crystalline compound EuBiT e3, Phys. Rev. B 100, 024433 (2019)

    2019

  47. [66]

    J. B. Torrance, M. W. Shafer, and T. R. McGuire, Bound magnetic polarons and the insulator- metal transition in EuO, Phys. Rev. Lett. 29, 1168 (1972)

    1972

  48. [67]

    Kresse and J

    G. Kresse and J. Hafner, Ab initio molecular dynamics for liquid metals, Phys. Rev. B 47, 558 (1993). 20

    1993

  49. [68]

    Kresse and J

    G. Kresse and J. Furthm¨ uller, Efficient iterative schemes for ab initio total-energy calculations using a plane-wave basis set, Phys. Rev. B 54, 11169 (1996)

    1996

  50. [69]

    Kresse and J

    G. Kresse and J. Furthm¨ uller, Efficiency of ab-initio total energy calculations for metals and semiconductors using a plane-wave basis set, Computational materials science 6, 15 (1996)

    1996

  51. [70]

    Tran and P

    F. Tran and P. Blaha, Accurate band gaps of semiconductors and insulators with a semilocal exchange-correlation potential, Phys. Rev. Lett. 102, 226401 (2009)

    2009

  52. [71]

    Koller, F

    D. Koller, F. Tran, and P. Blaha, Improving the modified becke-johnson exchange potential, Phys. Rev. B 85, 155109 (2012)

    2012

  53. [72]

    Cuono, R

    G. Cuono, R. M. Sattigeri, C. Autieri, and T. Dietl, Ab initio overestimation of the topological region in Eu-based compounds, Phys. Rev. B 108, 075150 (2023). 21

    2023

Pith tools

Reviewed August 5, 2026 · model on record in the stance chip above.