Pith. sign in

REVIEW 3 major objections 6 minor 1 cited by

A Systematic Review of Spatio-Temporal Statistical Models: Theory, Structure, and Applications

T0 review · 3 major / 6 minor · reviewed 2026-08-04 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read The paper claims that a systematic, cross-disciplinary review of spatio-temporal statistical models was missing, and proposes a classification scheme that reveals hierarchical models dominate current practice while modeling preferences diff

desk verdict Useful, transparent PRISMA review with a workable classification, but the field-difference claims rest on a keyword-restricted sample and need a sensitivity check before I'd trust them. read the letter →

arxiv 2511.00422 v2 pith:QTTWF5TK submitted 2025-11-01 stat.AP

Isabella Habereder , Thomas Kneib , Isao Echizen , Timo Spinde This is my paper · ORCID
classification stat.AP
keywords spatio-temporalmodelssystematicreviewclassificationschemehierarchicaladditivestructureslagapplicationdomainsreproducibility
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper argues that no existing review combines a classification of spatio-temporal statistical model structures with a cross-domain survey of applications, and that this gap matters because researchers in one field rarely borrow models from another. To close it, the authors systematically reviewed 83 papers from 2021-2025 across five application domains and propose a two-level classification scheme: first flat vs hierarchical architecture, then additive, lag, intensity, and other structures. They find hierarchical models are the most common, additive structures are used in at least half of models in every field, and fields differ sharply—economics uses only flat lag-based models while criminology uses only hierarchical ones. They also report that Bayesian methods dominate outside economics and that code is publicly available for only a minority of papers. If true, the review gives applied researchers a shared vocabulary for comparing model structures and a map of where cross-field borrowing is most needed.

What carries the argument

The classification scheme itself is the central mechanism. It builds on the distinction between flat and hierarchical architectures—where hierarchical models factor the joint distribution into a data model and a process model—and then classifies the dependence structure into additive spatio-temporal components (u_s + v_t + gamma_{t,s}), lag structures (spatial weight matrices, temporal autoregressions, and their combinations), intensity functions for point processes, and a residual 'other' category. This scheme is what lets the authors compare structures across fields and produce the paper's distributional findings.

What would settle it

Re-run the review's search without the exact-keyword restriction or including journals outside Q1/CORE A, and count hierarchical vs flat models in economics. If hierarchical models appear in economics at a comparable rate to other fields, the paper's central distributional claim fails; if the pattern persists, it is robust. A second check: search for applied spatio-temporal papers in economics journals that mention hierarchical or Bayesian models to see whether the zero count is an artifact.

Watch

Extended reading notes

Core claim

The central discovery is a working taxonomy that organizes the model structures actually used in current spatio-temporal statistics into a small number of recurring types. At the top level, models split into flat architectures, which model the data process directly, and hierarchical architectures, which factor the joint distribution into a data model and a latent process model. Below that, the spatio-temporal dependence is captured either by additive components (spatial, temporal, and spatio-temporal effects such as CAR/BYM, random walks, Gaussian processes, and splines), by lag structures (spatial, temporal, or spatio-temporal lags of covariates, errors, or the target), by intensity functio

Load-bearing premise

The review's quantitative findings rest entirely on the 83 papers that survived its search filters—two databases, exact keyword restrictions, Q1 journals and A-ranked conferences, 2021-2025—so if those filters systematically exclude relevant work (for instance, hierarchical models in economics or applied work in lower-ranked venues), the observed field differences could be artifacts of selection rather than real practices.

Editorial extensions

If this is right

  • Applied statisticians gain a simple checklist—flat or hierarchical, additive or lag or intensity—for locating their model in the broader landscape.
  • The finding that economics uses flat lag models while criminology uses only hierarchical models suggests fields can learn from each other's toolkits, e.g., hierarchical structures for nested economic data.
  • The predominance of additive structures across fields implies that new methods for space-time interactions can be plugged into most existing model families.
  • Documentation that Bayesian methods dominate 56 of 83 papers outside economics points to continued demand for scalable Bayesian computation.
  • The low code-availability rate (34 of 83, some on request) indicates a concrete reproducibility gap that journals could close with data/code policies.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • If search-filter sensitivity is real, the striking 'no hierarchical models in economics' result may reflect the sample of Q1 journals and exact keywords rather than actual economic practice; a replication that includes lower-ranked or methods-focused outlets could overturn this specific distribution.
  • The taxonomy could be applied to pre-2021 literature to test whether model preferences are stable or shifting, e.g., whether hierarchical models are growing outside health fields.
  • The paper's focus on interpretable statistical models suggests a natural extension: classifying hybrid statistical-deep-learning models under the same scheme to see whether they follow the same field-specific patterns.
  • The near-absence of cross-domain citations among the reviewed papers implies that a shared taxonomy might actually change citation behavior; a before/after bibliometric test is possible.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 6 minor

Summary. The paper reports a PRISMA-guided systematic review of 83 publications (2021–2025) that apply spatio-temporal statistical models in applied domains. Its main contributions are (i) a classification scheme distinguishing flat versus hierarchical model architectures and further decomposing model characteristics into additive components, lag structures, intensity functions, and other strategies, and (ii) a cross-domain synthesis of how these structures are used in epidemiology, ecology, public health, economics, criminology, and a small 'others' category. The central empirical claims are that hierarchical models are the most frequent architecture overall, that additive spatio-temporal components dominate, and that field-specific preferences exist—most strikingly, no hierarchical models are found in economics while all six criminology papers use hierarchical models. The authors also report limitations in data quality, model assumptions, and reproducibility, and note that code is absent for a majority of reviewed papers.

Significance. If the sample is representative, the review fills a real gap: existing surveys are either domain-specific or model-class-specific, whereas this paper provides an explicit, cross-disciplinary classification scheme and links it to application contexts. The methodology is transparent and reproducible in important respects: the PRISMA flow is documented, search strings are given, and the repository is public. The mathematical formalization of the classification scheme is a useful resource for practitioners seeking to identify or compare model structures. However, the significance of the frequency-based claims, including the headline field contrasts, rests entirely on the representativeness of the 83 included papers. Because the selection procedure involves strong filters and no sensitivity analysis, the descriptive conclusions are currently more fragile than the narrative suggests. If the authors address this by either adding sensitivity analyses or carefully re-scoping the claims, the paper would be a valuable contribution to interdisciplinary statistical practice.

major comments (3)
  1. [§2.2, §4.3.2, Tables 9, 14, 15] The exact-keyword Scopus filter, combined with the Q1/CORE-A venue restriction, is load-bearing for the central descriptive claims of RQ1 and RQ2. The authors state that the unrestricted search retrieved nearly twice as many records but 'without substantially limiting the coverage of the research field' (Section 2.2); no sensitivity analysis supports this assertion. The claim that no hierarchical models are used in economics (Section 4.3.2, Table 14) rests on six papers, and the search string omits terms such as 'Bayesian spatial econometrics' or 'hierarchical Bayes', so the finding may be an artifact of the keyword filter rather than a true field difference. Similarly, the all-hierarchical result for criminology (Table 15) is based on six papers. Please provide a sensitivity analysis comparing the included sample with the unrestricted Scopus results, or explicitly rephrase the cross-dom
  2. [§2.6, Figure 2] The quality assessment is an additional selection step that removes 128 of 211 full-text papers, yet the manuscript does not report how many reviewers performed the QA judgments, how disagreements were resolved, or any inter-rater reliability measure. Since QA1–QA7 are qualitative and applied sequentially, this introduces unquantified reviewer-dependent variation into the final sample. Given that the paper's frequency findings depend on the set of 83 papers, the QA step deserves the same transparency as the database search. Please report the number of screeners and the disagreement-resolution protocol, or provide a robustness check showing that the main field-level patterns are stable under plausible QA variations.
  3. [§4.2.1, Table 10] The flat/hierarchical architecture distinction is central to the review, but the mapping from individual papers to architecture labels is not fully auditable from the manuscript. Some papers appear more than once in Table 10 with only tick marks and no on-the-row indication of which extracted model corresponds to which classification decision. The repository may contain the full extraction, but the manuscript itself should either present the underlying per-model assignments or provide a clearer key so a reader can verify, for example, why the two entries for [8] receive different classifications. This is a reproducibility concern for the main classification scheme.
minor comments (6)
  1. [§4.2.2] The notation for the latent process contains a typo: it should read Y := {Y_{t,s} | (t,s) ∈ D_s × D_t}, not D_t × D_t. The same error appears in the surrounding text.
  2. [Figure 2] The PRISMA flow diagram appears mislabeled in the rendered version: the 'Records excluded (n = 88)' label is attached to the 'Abstract screening' box in the figure, whereas the text (Section 4.1) states that the 88 exclusions occur during journal/conference ranking. Please align the figure with the text.
  3. [§5.1] The code-availability sentence is ambiguous: 'Code is available for only 34 publications. However, for five papers, it is only available upon request.' Clarify whether the 34 includes the 5 upon-request cases; as written, it may appear to sum to 88 rather than 83.
  4. [§2.4] The statement that existing classifications were 'used both of these to validate the groups found' is vague. Please describe concretely how the textbook taxonomies [26, 29, 109] were used to validate or revise the inductively derived categories.
  5. [Table 10] The table legend defines B and F but does not explain the meaning of the x marks or the columns. Add a note clarifying that x indicates presence of the given feature for that row's model.
  6. [§4.3.2] The text reports '60 hierarchical models and 26 flat models,' while the review includes 83 publications. Since some papers contribute multiple models, this is not necessarily an error, but please state explicitly that the counts are per model, not per publication, to avoid apparent inconsistency.

Circularity Check

0 steps flagged · score 1.0 of 10

No meaningful circularity: the review's claims are empirical summaries of an external literature, and the only self-citations are illustrative, not load-bearing.

full rationale

This is a systematic literature review, not a derivation with fitted parameters or constructed predictions. Its central outputs are (i) a classification scheme for spatio-temporal model structures and (ii) frequency counts of model architectures across application domains. The classification scheme is explicitly grounded in and validated against established external textbooks and overview works: 'existing classifications and systematizations from established textbooks [26, 29, 109] were considered. We used both of these to validate the groups found and to develop and formulate the categories in terms of content' (Section 2.4). The frequency findings, such as 'hierarchical models are used significantly more often than flat models' and 'in economics, no hierarchical models are used' (Section 4.3.2), are direct codings of the 83 included papers, with per-paper classifications given in Table 10. These claims are not equivalent to the review's own inputs; they are empirical summaries that could be checked against the cited primary studies. The only self-citations are Spinde et al. [90]-[93], and they appear merely as examples of possible future application areas ('media research for analyzing media bias [92, 93]', Section 5.2, RQ2) or as illustrative references in the introduction. They are not used to justify the classification scheme, the selection criteria, or any frequency claim, and no uniqueness theorem or prior self-derived result is invoked. The potential concern that the Scopus keyword restriction and Q1/CORE-A filters may skew field-level comparisons is a selection-bias or representativeness issue, not circularity: the findings remain externally grounded in the retrieved literature. No step in the paper reduces by construction to its own inputs.

Assumptions & free parameters 5 free parameters · 4 assumptions · 0 invented entities

No physical or statistical entities are invented; the review's 'free parameters' are methodological choices that shape the sample and the resulting descriptive statistics.

free parameters (5)
  • Publication year window = 2021-2025
    Chosen to capture recent practice; restricts coverage and thus affects the frequency counts.
  • Journal/conference ranking threshold = Scimago Q1 and CORE A
    Used as a quality filter; excludes many applied papers, potentially biasing the sample toward certain fields.
  • Scopus exact-keyword restriction = EXACTKEYWORD 'Spatio-temporal Models' or 'Spatiotemporal Analysis'
    Added to enhance precision; may miss papers using other terminology.
  • Language restriction = English
    Excludes non-English literature.
  • Number of databases = 2 (Scopus, Web of Science)
    Limited to two databases; may miss relevant sources not indexed there.
assumptions (4)
  • domain assumption The 83 included papers are representative of applied spatio-temporal statistical modeling in 2021-2025.
    The central descriptive findings about model frequencies depend on the sample's representativeness. The eligibility restrictions may violate this.
  • domain assumption The QA criteria (QA1-QA7) adequately distinguish methodologically sound studies.
    Inclusion relies on binary QA judgments without inter-rater reliability, introducing subjectivity.
  • domain assumption The classification scheme categories (flat vs hierarchical; additive vs lag; etc.) are unambiguous and cover the field.
    Manual classification of 86 models into these categories; ambiguous cases are resolved by the authors' judgment.
  • domain assumption Search strings and database coverage recover the relevant literature.
    The review relies on two databases and specific search strings; unindexed or differently-worded papers are excluded.

how reviews work

0 comments
Cite this review

Pith. "Pith review of A Systematic Review of Spatio-Temporal Statistical Models: Theory, Structure, and Applications." pith.science (2026). https://pith.science/paper/QTTWF5TK

@misc{pith2026251100422,
  author       = {Pith},
  title        = {Pith review of: A Systematic Review of Spatio-Temporal Statistical Models: Theory, Structure, and Applications},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/QTTWF5TK}},
  note         = {Machine review of arXiv:2511.00422}
}
read the original abstract

Data with spatio-temporal attributes are prevalent across many research fields, and statistical models for analyzing spatio-temporal relationships are widely used. Existing reviews focus either on specific domains or model types, creating a gap in comprehensive, cross-disciplinary overviews. To address this, we conducted a systematic literature review following the PRISMA guidelines, searched two databases for the years 2021-2025, and identified 83 publications that met our criteria. We propose a classification scheme for spatio-temporal model structures and highlight their application in the most common fields: epidemiology, ecology, public health, economics, and criminology. Although tasks vary by domain, many models share similarities. We found that hierarchical models are the most frequently used, and most models incorporate additive components to account for spatio-temporal dependencies. The preferred model structures differ among fields of application. We also observe that research efforts are concentrated in only a few specific disciplines, despite the broader relevance of spatio-temporal data. Furthermore, we notice that reproducibility remains limited. Our review, therefore, not only offers inspiration for comparing model structures in an interdisciplinary manner but also highlights opportunities for greater transparency, accessibility, and cross-domain knowledge transfer.

Figures

Figures reproduced from arXiv: 2511.00422 by the authors.

Figure 1
Figure 1. Illustration of a classification of our contribution [PITH_FULL_IMAGE:figures/full_fig_p004_1.png] view at source ↗
Figure 2
Figure 2. PRISMA flow diagram for new systematic reviews, [PITH_FULL_IMAGE:figures/full_fig_p006_2.png] view at source ↗
Figure 3
Figure 3. Illustration of our proposed scheme for classifying [PITH_FULL_IMAGE:figures/full_fig_p006_3.png] view at source ↗
Figures from the paper (1 more)
Figure 4
Figure 4. Figure 4: Graph of first-level citations that are cited more than once in the reviewed articles. The articles we reviewed [PITH_FULL_IMAGE:figures/full_fig_p016_4.png]

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. glmSTARMA -- An R-Package for fitting autoregressive spatio-temporal models following generalized linear models

    stat.CO 2026-07 conditional novelty 6.0 of 10

    glmSTARMA provides estimation, simulation, inference and prediction for spatio-temporal autoregressive GLMs with optional double-GLM dispersion dynamics at fixed locations.

Reference graph

Works this paper leans on

123 extracted references · 62 canonical work pages · cited by 1 Pith paper

  1. [8]

    BELOCONI, A., PROBST-HENSCH, N. M. and VOUNATSOU, P. (2021). Spatio-temporal modelling of changes in air pollution exposure associated to the COVID-19 lockdown measures across Europe.Science of the Total Envi- ronment787. https://doi.org/10.1016/j.scitotenv.2021.147607

    arXiv 2021

  2. [1]

    and ELHABIAN, S

    ADAMS, J., KHAN, N., MORRIS, A. and ELHABIAN, S. (2023). Learning spatiotemporal statistical shape models for non-linear dynamic anatomies.Frontiers in Bioengineering and Biotechnology11. https://doi.org/10.3389/fbioe.2023.1086234

    arXiv 2023

  3. [2]

    M., TORGO, L

    ALAM, M. M., TORGO, L. and BIFET, A. (2022). A survey on spatio-temporal data analytics systems.ACM Computing Sur- veys541–38. https://doi.org/10.1145/3507904

    work page doi:10.1145/3507904 2022

  4. [3]

    AMARAL, A. V. R., GONZÁLEZ, J. A. and MORAGA, P. (2023). Spatio-temporal modeling of infectious diseases by in- tegrating compartment and point process models.Stochastic Environmental Research and Risk Assessment371519–1533. https://doi.org/10.1007/s00477-022-02354-4

    work page doi:10.1007/s00477-022-02354-4 2023

  5. [4]

    M., MORAGA, P

    ASWI, A., CRAMB, S. M., MORAGA, P. and MENGERSEN, K. (2019). Bayesian spatial and spatio-temporal approaches to modelling dengue fever: a systematic review.Epidemiology and Infection147. https://doi.org/10.1017/S0950268818002807

    work page doi:10.1017/s0950268818002807 2019

  6. [5]

    and ESPOSTI, R

    BALDONI, E. and ESPOSTI, R. (2021). Agricultural Productiv- ity in Space: an Econometric Assessment Based on Farm-Level DataJEL codes.American Journal of Agricultural Economics 1031525–1544. https://doi.org/10.1111/ajae.12155

    work page doi:10.1111/ajae.12155 2021

  7. [6]

    A., PERAFITA, X

    BARCELÓ, M. A., PERAFITA, X. and SAEZ, M. (2024). Spatiotemporal variability in socioeconomic inequalities in COVID-19 vaccination in Catalonia, Spain.Public Health227 9–15. https://doi.org/10.1016/j.puhe.2023.11.024

    work page doi:10.1016/j.puhe.2023.11.024 2024

  8. [7]

    and TIAN, Z

    BEI, C., LIU, S., LIAO, Y., TIAN, G. and TIAN, Z. (2021). Predicting new cases of COVID-19 and the application to popu- lation sustainability analysis.Accounting and Finance614859–

    2021

Show all 123 references
  1. [9]

    and MOLLIÉ, A

    BESAG, J., YORK, J. and MOLLIÉ, A. (1991). Bayesian image restoration, with two applications in spatial statistics.Annals of the institute of statistical mathematics431–20. https://doi.org/ 10.1007/BF00116466

    1991 doi

  2. [10]

    and ZEWOTIR, T

    BOFA, A. and ZEWOTIR, T. (2024). Optimizing spatio- temporal correlation structures for modeling food security in Africa: a simulation-based investigation.BMC Bioinformatics

    2024

  3. [11]

    and ZEWOTIR, T

    BOFA, A. and ZEWOTIR, T. (2024). A bayesian spatio- temporal dynamic analysis of food security in Africa.Scientific Reports14. https://doi.org/10.1038/s41598-024-65989-z

    2024 doi

  4. [12]

    and HELD, L

    BRACHER, J. and HELD, L. (2022). Endemic-epidemic models with discrete-time serial interval distributions for infectious dis- ease prediction.International Journal of Forecasting381221–

    2022

  5. [13]

    BRIZ-REDÓN, A. (2021). The impact of modelling choices on modelling outcomes: a spatio-temporal study of the asso- ciation between COVID-19 spread and environmental condi- tions in Catalonia (Spain).Stochastic Environmental Research and Risk Assessment351701–1713. https://doi....

    2021

  6. [14]

    BRIZ-REDÓN, A. (2024). A Bayesian Aoristic Logistic Re- gression to Model Spatio-Temporal Crime Risk Under the Pres- ence of Interval-Censored Event Times.Journal of Quantitative Criminology40621–644. https://doi.org/10.1007/s10940-023- 09580-1

    2024 doi

  7. [15]

    F., DEAN- DRÉS, J., LOZANO, M

    BRIZ-REDÓN, A., IFTIMI, A., CORRECHER, J. F., DEAN- DRÉS, J., LOZANO, M. and ROMERO-GARCÍA, C. (2022). A comparison of multiple neighborhood matrix specifications for spatio-temporal model fitting: a case study on COVID-19 data.Stochastic Environmental Research and Risk Assess...

    2022 doi

  8. [16]

    and SERRANO-AROCA, A

    BRIZ-REDÓN, A. and SERRANO-AROCA, A. (2022). On the association between COVID-19 vaccination levels and inci- dence and lethality rates at a regional scale in Spain.Stochastic Environmental Research and Risk Assessment362941–2948. https://doi.org/10.1007/s00477-021-02166-y

    2022 doi

  9. [17]

    G., LEE, N

    BYUN, H. G., LEE, N. and HWANG, S. S. (2021). A system- atic review of spatial and spatio-temporal analyses in public health research in korea.Journal of Preventive Medicine and Public Health54301–308. https://doi.org/10.3961/jpmph.21. 160

    2021 doi

  10. [18]

    and PRENTICE, C

    CARROLL, R. and PRENTICE, C. R. (2021). Community vulnerability and mobility: What matters most in spatio- temporal modeling of the COVID-19 pandemic?Social Science and Medicine287. https://doi.org/10.1016/j.socscimed.2021. 114395

    2021 doi

  11. [19]

    CHEN, B., CHEN, Z., LIU, X. C. and YI, Z. (2024). Bayesian inference-based spatiotemporal modeling with interim activi- ties for EV charging etiquette.Transportation Research Part D: Transport and Environment127. https://doi.org/10.1016/j. trd.2024.104060

    2024

  12. [20]

    and ZHANG, Y

    CHEN, Z., DENG, X., ZOU, Y., HE, Y., CHEN, S., WANG, Q., XING, D. and ZHANG, Y. (2023). A Spatio-temporal Bayesian model to estimate risk and influencing factors related to tuber- culosis in Chongqing, China, 2014-2020.Archives of Public Health81. https://doi.org/10.1186/s1369...

    2023 doi

  13. [21]

    and FREYNE, B

    CHIROMBO, J., MAJAMANDA, A., GUNSARU, V., YOSEFE, S., OZITUOSAUKA, W., MCHOMA, C., MOR- RONI, C., CHIPETA, E., MACPHERSON, P. and FREYNE, B. (2024). The prevalence of gestational syphilis in Malawi between 2014 and 2022: spatiotemporal modeling of population-level factors.Fron...

    2024

  14. [22]

    and POZZI, M

    CHOI, B., BERGÉS, M., BOU-ZEID, E. and POZZI, M. (2021). Short-term probabilistic forecasting of meso-scale near-surface urban temperature fields.Environmental Modelling and Soft- ware145. https://doi.org/10.1016/j.envsoft.2021.105189

    2021

  15. [23]

    and HUMMEL, M

    CHOI, B. and HUMMEL, M. A. (2025). Spatiotemporal air quality prediction using stochastic advection–diffusion model for multimodal data fusion.Environmental Research Letters20. https://doi.org/10.1088/1748-9326/ada397

    2025 doi

  16. [24]

    and DIXON, P

    CLARK, N. and DIXON, P. (2021). A class of spatially cor- related self-exciting statistical models.Spatial Statistics43. https://doi.org/10.1016/j.spasta.2021.100493

    2021

  17. [25]

    https://doi.org/10.1186/s12859-024-05791-w

    doi

  18. [26]

    and WIKLE, C

    CRESSIE, N. and WIKLE, C. K. (2011).Statistics for Spatio- Temporal Data.Wiley Series in Probability and Statistics. John Wiley & Sons

    2011

  19. [27]

    andDEPON- TUAL, H

    DAMBRINE, C., WOILLEZ, M., HURET, M. andDEPON- TUAL, H. (2021). Characterising Essential Fish Habitat using spatio-temporal analysis of fishery data: A case study of the European seabass spawning areas.Fisheries Oceanography30 413–428. https://doi.org/10.1111/fog.12527

    2021 doi

  20. [28]

    and ELHORST, J

    COSTANTINO, S., CRACOLICI, M. and ELHORST, J. (2023). A spatial origin-destination approach for the analysis of local tourism demand in Italy.Papers in Regional Science102393–

    2023

  21. [29]

    ELHORST, J. P. (2014).Spatial Econometrics: From Cross- Sectional Data to Spatial Panels.SpringerBriefs in Regional Science479. Springer. https://doi.org/10.1007/978-3-642- 40340-8

    2014 doi

  22. [30]

    and GREENHOUSE, B

    EPSTEIN, A., NAMUGANGA, J., NABENDE, I., KAMYA, E., KAMYA, M., DORSEY, G., STURROCK, H., BHATT, S., RODRIGUEZ-BARRAQUER, I. and GREENHOUSE, B. (2023). Mapping malaria incidence using routine health facility surveil- lance data in Uganda.BMJ Global Health8. https://doi.org/10. ...

    2023

  23. [31]

    FAGAN, J. C. (2017). An evidence-based review of academic web search engines, 2014-2016: Implications for librarians’ practice and research agenda.Information Technology and Li- braries367–47. https://doi.org/10.6017/ital.v36i2.9718

    2017 doi

  24. [32]

    and EMILI, S

    ELHORST, J. and EMILI, S. (2022). A spatial economet- ric multivariate model of Okun’s law.Regional Science and Urban Economics93. https://doi.org/10.1016/j.regsciurbeco. 2021.103756

    2022

  25. [33]

    and CAT- TANI, G

    FIORAVANTI, G., MARTINO, S., CAMELETTI, M. and CAT- TANI, G. (2021). Spatio-temporal modelling of PM10 daily concentrations in Italy using the SPDE approach.Atmo- spheric Environment248. https://doi.org/10.1016/j.atmosenv. 2021.118192

    2021

  26. [34]

    P., SCHMIDT, A

    FREITAS, L. P., SCHMIDT, A. M., COSSICH, W., CRUZ, O. G. and CARVALHO, M. S. (2021). Spatio-temporal modelling of the first chikungunya epidemic in an intra-urban setting: The role of socioeconomic status, environment and temperature. PLoS Neglected Tropical Diseases15. https:...

    2021

  27. [35]

    C., BEACHAM, T

    FRESHWATER, C., ANDERSON, S. C., BEACHAM, T. D., LUEDKE, W., WOR, C. and KING, J. (2021). An integrated model of seasonal changes in stock composition and abun- dance with an application to Chinook salmon.PeerJ9. https: //doi.org/10.7717/peerj.11163

    2021 doi

  28. [36]

    E., PITSOUNI, E

    FALAGAS, M. E., PITSOUNI, E. I., MALIETZIS, G. A. and PAPPAS, G. (2008). Comparison of PubMed, Scopus, web of science, and Google scholar: strengths and weaknesses. The FASEB journal22338–342. https://doi.org/10.1096/fj.07- 9492LSF

    2008 doi

  29. [37]

    M., SERRE, M., WISE, E

    GÓMEZ, A. M., SERRE, M., WISE, E. and PAVELSKY, T. (2021). Integrating Community Science Research and Space- Time Mapping to Determine Depth to Groundwater in a Re- mote Rural Region.Water Resources Research57. https://doi. org/10.1029/2020WR029519

    2021 doi

  30. [38]

    A., RODRÍGUEZ-CORTÉS, F

    GONZÁLEZ, J. A., RODRÍGUEZ-CORTÉS, F. J., CRONIE, O. and MATEU, J. (2016). Spatio-temporal point process statis- tics: A review.Spatial Statistics18505–544. https://doi.org/ 10.1016/j.spasta.2016.10.002

    2016 doi

  31. [39]

    and LILA, M

    GRACIA, E., MARCO, M., LÓPEZ-QUÍLEZ, A. and LILA, M. (2021). Chronic high risk of intimate partner violence against women in disadvantaged neighborhoods: An eight-year space- time analysis.Preventive Medicine148. https://doi.org/10. 1016/j.ypmed.2021.106550

    2021

  32. [40]

    A., ACERO, F

    GARCÍA, J. A., ACERO, F. J. and PORTERO, J. (2023). A Bayesian hierarchical spatio-temporal model for extreme tem- peratures in Extremadura (Spain) simulated by a Regional Cli- mate Model.Climate Dynamics611489–1503. https://doi.org/ 10.1007/s00382-022-06638-x

    2023 doi

  33. [41]

    R., THORSON, J

    GRÜSS, A., CHARSLEY, A. R., THORSON, J. T., ANDER- SON, O. F., O’DRISCOLL, R. L., WOOD, B., BREIVIK, O. N. and O’LEARY, C. A. (2023). Integrating survey and observer data improves the predictions of New Zealand spatio-temporal models.ICES Journal of Marine Science801991–2007. ...

    2023 doi

  34. [42]

    and JIANG, L

    HE, S. and JIANG, L. (2021). Identifying convergence in ni- trogen oxides emissions from motor vehicles in China: A spa- tial panel data approach.Journal of Cleaner Production316. https://doi.org/10.1016/j.jclepro.2021.128177

    2021

  35. [43]

    and ZONG, S

    HUANG, J., LU, X., LIU, H. and ZONG, S. (2021). The driv- ing forces of anoplophora glabripennis have spatial spillover effects.Forests12. https://doi.org/10.3390/f12121678

    2021 doi

  36. [44]

    and LI, B

    GRIFFITH, D. and LI, B. (2021). Spatial-temporal modeling of initial COVID-19 diffusion: The cases of the Chinese Main- land and Conterminous United States.Geo-Spatial Information Science24340–362. https://doi.org/10.1080/10095020.2021. 1937338

    2021

  37. [45]

    K., A AMIKIYA, E

    IDDRISU, A. K., A AMIKIYA, E. and KWAMEBUKARI, F. (2022). Spatio-temporal characteristics of Tuberculosis in Ghana.F1000Research11200. https://doi.org/10.12688/ f1000research.109053.2

    2022

  38. [46]

    and MATEU, J

    JALILIAN, A. and MATEU, J. (2021). A hierarchical spatio- temporal model to analyze relative risk variations of COVID- 19: a focus on Spain, Italy and Germany.Stochastic Envi- ronmental Research and Risk Assessment35797–812. https: //doi.org/10.1007/s00477-021-02003-2

    2021 doi

  39. [47]

    and CHOI, J

    JEONG, J., KIM, M. and CHOI, J. (2023). Investigating the spatio-temporal variation of hepatitis A in Korea using a Bayesian model.Frontiers in Public Health10. https://doi.org/ 10.3389/fpubh.2022.1085077

    2023

  40. [48]

    U., MWAMBI, H

    IBEJI, J. U., MWAMBI, H. and IDDRISU, A. K. (2022). Bayesian spatio-temporal modelling and mapping of malaria and anaemia among children between 0 and 59 months in Nige- ria.Malaria Journal21. https://doi.org/10.1186/s12936-022- 04319-y

    2022 doi

  41. [49]

    and PAPADAKIS, N

    KOUTSAKI, E., VARDAKIS, G. and PAPADAKIS, N. (2023). Spatiotemporal data mining problems and methods.Analytics2 485–508. https://doi.org/10.3390/analytics2020027

    2023 doi

  42. [50]

    R., RICHARDSON, S., ROWE, W., ROWLING- SON, B., TORABI, F., WADE, M

    LI, G., DENISE, H., DIGGLE, P., GRIMSLEY, J., HOLMES, C., JAMES, D., JERSAKOVA, R., MOLE, C., NICHOLSON, G., SMITH, C. R., RICHARDSON, S., ROWE, W., ROWLING- SON, B., TORABI, F., WADE, M. J. and BLANGIARDO, M. (2023). A spatio-temporal framework for modelling wastew- ater conc...

    2023 doi

  43. [51]

    and RUE, H

    LINDGREN, F. and RUE, H. (2015). Bayesian spatial modelling with R-INLA.Journal of statistical software631–25. https: //doi.org/10.18637/jss.v063.i19

    2015 doi

  44. [52]

    KNORR-HELD, L. (2000). Bayesian modelling of inseparable space-time variation in disease risk.Statistics in medicine19 2555–2567. https://doi.org/10.5282/ubm/epub.1536

    2000 doi

  45. [53]

    C., GOGINA, M

    LINDMARK, M., ANDERSON, S. C., GOGINA, M. and CASINI, M. (2023). Evaluating drivers of spatiotemporal vari- ability in individual condition of a bottom-associated marine A SYSTEMATIC REVIEW OF SPATIO-TEMPORAL STATISTICAL MODELS23 fish, Atlantic cod (Gadus morhua).ICES Journal ...

    2023 doi

  46. [54]

    S., MILLER, K

    LIU, B., ZHU, L., ZOU, J., CHEN, H. S., MILLER, K. D., JE- MAL, A., SIEGEL, R. L. and FEUER, E. J. (2021). Updated methodology for projecting U.S.- And state-level cancer counts for the current calendar year: Part i: Spatio-temporal mod- eling for cancer incidence.Cancer Epide...

    2021 doi

  47. [55]

    and ZHANG, Z

    LIU, X., SUN, Y., YIN, Y., DAI, X., BERGQUIST, R., GAO, F., LIU, R., LIU, J., WANG, F., LV, X. and ZHANG, Z. (2023). In- fluence of urbanization on schistosomiasis infection risk in An- hui Province based on sixteen year’s longitudinal surveillance data: a spatio-temporal mode...

    2023 doi

  48. [56]

    and LINDSTRÖM, J

    LINDGREN, F., RUE, H. and LINDSTRÖM, J. (2011). An explicit link between Gaussian fields and Gaussian Markov random fields: the stochastic partial differential equation ap- proach.Journal of the Royal Statistical Society Series B: Statis- tical Methodology73423–498. https://do...

    2011

  49. [57]

    and WHITE, P

    LOME-HURTADO, A., LI, G., TOUZA-MONTERO, J. and WHITE, P. C. L. (2021). Patterns of low birth weight in greater Mexico City: A Bayesian spatio-temporal analysis.Applied Ge- ography134. https://doi.org/10.1016/j.apgeog.2021.102521

    2021

  50. [58]

    J., MUÑOZ-QUILES, C

    LÓPEZ-LACORT, M., CORBERÁN-VALLET, A., BRIZ- REDÓN,A., SANTONJAGÓMEZ, F. J., MUÑOZ-QUILES, C. and ORRICO-SÁNCHEZ, A. (2024). A Bayesian spatio- temporal model for cluster detection: identifying HPV suboptimal vaccine coverage.Stochastic Environmen- tal Research and Risk Assess...

    2024 doi

  51. [59]

    and MARBUAH, G

    LOZANO, J., ELOFSSON, K., SURRY, Y. and MARBUAH, G. (2023). Spatio-Temporal Analysis of Game Harvests in Swe- den.Environmental & Resource Economics85385–408. https: //doi.org/10.1007/s10640-023-00770-w

    2023 doi

  52. [60]

    J., BOKLUND, A

    LIU, Y., KJÆR, L. J., BOKLUND, A. E., CLAUSEN, P., NYE- GAARD, T., WARD, M. P., LAFFAN, S. and KIRKEBY, C. T. (2025). The role of wild birds in transmitting highly pathogenic avian influenza in Denmark: An exploration using a spatiotem- poral model.Ecological Modelling501. htt...

    2025

  53. [61]

    andVAN DER MEI, R

    MAHFOUD, M., BERNASCO, W., BHULAI, S. andVAN DER MEI, R. (2021). Forecasting Spatio-Temporal Variation in Res- idential Burglary with the Integrated Laplace Approximation Framework: Effects of Crime Generators, Street Networks, and Prior Crimes.Journal of Quantitative Criminol...

    2021 doi

  54. [62]

    and LU, Y

    MAIA, A. and LU, Y. (2021). Migration and Democratization in Brazil: The Case of Electoral Participation and Competition. Demography58191–217. https://doi.org/10.1215/00703370- 8937033

    2021 doi

  55. [63]

    E., KELLER, J

    MARTENIES, S. E., KELLER, J. P., WEMOTT, S., KUIPER, G., ROSS, Z., ALLSHOUSE, W. B., ADGATE, J. L., STARLING, A. P., DABELEA, D. and MAGZAMEN, S. (2021). A Spatiotemporal Prediction Model for Black Carbon in the Denver Metropolitan Area, 2009-2020. Environmental Science and Te...

    2021 doi

  56. [64]

    L., PAN, J., HÄRDLE, W

    MA, S., YU, K., TANG, M. L., PAN, J., HÄRDLE, W. K. and TIAN, M. (2023). A Bayesian multistage spatio-temporally dependent model for spatial clustering and variable selection. Statistics in Medicine424794–4823. https://doi.org/10.1002/ sim.9889

    2023

  57. [65]

    and FRANSES, P

    MATTERA, R. and FRANSES, P. (2025). Forecasting house price growth rates with factor models and spatio-temporal clus- tering.International Journal of Forecasting41398–417. https: //doi.org/10.1016/j.ijforecast.2024.09.003

    2025 doi

  58. [66]

    R., KEITH, D

    MCDONALD, R. R., KEITH, D. M., SAMEOTO, J. A. and MILLSFLEMMING, J. (2023). Integrating habitat features into spatio-temporal biomass dynamics models for a better under- standing of stock productivity: a case study of sea scallop in the Bay of Fundy.ICES Journal of Marine Scie...

    2023 doi

  59. [67]

    J., WITHEY, J

    NEUPANE, N., PERUZZI, M., ARAB, A., MAYOR, S. J., WITHEY, J. C., RIES, L. and FINLEY, A. O. (2022). A novel model to accurately predict continental-scale timing of forest green-up.International Journal of Applied Earth Observation and Geoinformation108. https://doi.org/10.1016...

    2022 doi

  60. [68]

    and PENNINO, M

    MARTÍNEZ-MINAYA, J., CAMELETTI, M., CONESA, D. and PENNINO, M. (2018). Species distribution modeling: a statis- tical review with focus in spatio-temporal issues.Stochastic Environmental Research and Risk Assessment323227–3244. https://doi.org/10.1007/s00477-018-1548-7

    2018 doi

  61. [69]

    A., BARTELS, D

    NGUYEN, V. A., BARTELS, D. W. and GILLIGAN, C. A. (2023). Modelling the spread and mitigation of an emerging vector-borne pathogen: Citrus greening in the U.S.PLoS Com- putational Biology19. https://doi.org/10.1371/journal.pcbi. 1010156

    2023 doi

  62. [70]

    NGWIRA, A., KUMWENDA, F., MUNTHALI, E. C. S. and NKOLOKOSA, D. (2021). Spatial temporal distribution of COVID-19 risk during the early phase of the pandemic in Malawi.PeerJ9. https://doi.org/10.7717/peerj.11003

    2021 doi

  63. [71]

    C., ATILOLA, G., KOMBA, P., MA- VATIKUA, L., MOORE, Z., MATANDA, D., OBIANWU, O

    NNANATU, C. C., ATILOLA, G., KOMBA, P., MA- VATIKUA, L., MOORE, Z., MATANDA, D., OBIANWU, O. and KANDALA, N. B. (2021). Evaluating changes in the preva- lence of female genital mutilation/cutting among 0-14 years old girls in Nigeria using data from multiple surveys: A novel B...

    2021 doi

  64. [72]

    H., NGUYEN, T

    NGUYEN, M. H., NGUYEN, T. H. T., MOLENBERGHS, G., ABRAMS, S., HENS, N. and FAES, C. (2023). The impact of national and international travel on spatio-temporal transmis- sion of SARS-CoV-2 in Belgium in 2021.BMC Infectious Dis- eases23. https://doi.org/10.1186/s12879-023-08368-9

    2023 doi

  65. [73]

    OLMOS, M., IANELLI, J., CIANNELLI, L., SPIES, I., MCGILLIARD, C. R. and THORSON, J. T. (2023). Estimat- ing climate-driven phenology shifts and survey availability us- ing fishery-dependent data.Progress in Oceanography215. https://doi.org/10.1016/j.pocean.2023.103035

    2023

  66. [74]

    and UGARTE, M

    OROZCO-ACOSTA, E., RIEBLER, A., ADIN, A. and UGARTE, M. D. (2023). A scalable approach for short-term disease forecasting in high spatial resolution areal data.Bio- metrical Journal65. https://doi.org/10.1002/bimj.202300096

    2023 doi

  67. [75]

    PAGE, M., MCKENZIE, J., BOSSUYT, P., BOUTRON, I., HOFFMANN, T., MULROW, C., SHAMSEER, L., TET- ZLAFF, J., AKL, E., BRENNAN, S. et al. (2021). The PRISMA 2020 statement: an updated guideline for reporting systematic reviews.BMJ372. https://doi.org/10.1136/bmj.n71

    2021 doi

  68. [76]

    N., DOLAN, C

    ODHIAMBO, J. N., DOLAN, C. B., TROUP, L. and RO- JAS, N. P. (2023). Spatial and spatio-temporal epidemiologi- cal approaches to inform COVID-19 surveillance and control: a systematic review of statistical and modelling methods in Africa.BMJ Open13. https://doi.org/10.1136/bmjo...

    2023 doi

  69. [77]

    and FAES, C

    PETROF, O., NEYENS, T., VAES, B., JANSSENS, A. and FAES, C. (2024). Using a general practice research database to assess the spatio-temporal COVID-19 risk.BMC Primary Care

    2024

  70. [78]

    PIETAK, L. (2024). Effect of regional disparities on national economic growth. A spatial panel data evidence from EU coun- tries in 2000-2020.Journal of Economic Inequality. https: //doi.org/10.1007/s10888-024-09658-1

    2024 doi

  71. [79]

    S., BAR- BOSA, G

    PIRANI, M., LORENZ, C.,DEAZEVEDO, T. S., BAR- BOSA, G. L., BLANGIARDO, M. and CHIARAVALLOTI- NETO, F. (2024). Effects of the El Niño-Southern Oscilla- tion and seasonal weather conditions on Aedes aegypti infes- tation in the State of São Paulo (Brazil): A Bayesian spatio- tem...

    2024 doi

  72. [80]

    M., HELSKE, J., HÖGMANDER, H

    PASANEN, T. M., HELSKE, J., HÖGMANDER, H. and KE- TOLA, T. (2024). Spatio-temporal modeling of co-dynamics of smallpox, measles, and pertussis in pre-healthcare Finland. PeerJ12. https://doi.org/10.7717/peerj.18155

    2024 doi

  73. [81]

    REINHART, A. (2018). A Review of Self-Exciting Spatio- Temporal Point Processes and Their Applications.Statistical Science33. https://doi.org/10.1214/17-STS629

    2018 doi

  74. [82]

    https://doi.org/10.1186/s12875-024-02423-3 24

    doi

  75. [83]

    and BARCELÓ, M

    SAEZ, M. and BARCELÓ, M. A. (2022). Spatial prediction of air pollution levels using a hierarchical Bayesian spatiotempo- ral model in Catalonia, Spain.Environmental Modelling and Software151. https://doi.org/10.1016/j.envsoft.2022.105369

    2022

  76. [84]

    SAHU, S. K. and MARDIA, K. V. (2005). Recent Trends in Modeling Spatio-Temporal Data. InMeeting of the Italian Sta- tistical Society on Statistics and the Environment, Messina, Italy. 20–22 September 200569–83

    2005

  77. [85]

    and KAUERMANN, G

    RACEK, D., THURNER, P. and KAUERMANN, G. (2025). Cap- turing the spatio-temporal diffusion effects of armed conflict: A nonparametric smoothing approach.Journal of the Royal Sta- tistical Society Series A-Statistics in Society. https://doi.org/10. 1093/jrsssa/qnaf120

    2025

  78. [86]

    and TEBÉ, C

    SATORRA, P. and TEBÉ, C. (2024). Bayesian spatio-temporal analysis of the COVID-19 pandemic in Catalonia.Scientific Re- ports14. https://doi.org/10.1038/s41598-024-53527-w

    2024 doi

  79. [87]

    and CHOPIN, N

    RUE, H., MARTINO, S. and CHOPIN, N. (2009). Approximate Bayesian inference for latent Gaussian models by using inte- grated nested Laplace approximations.Journal of the Royal Statistical Society Series B: Statistical Methodology71319–

    2009

  80. [88]

    SPELLMAN, B., GILBERT, E. A. and CORKER, K. S. (2017). Open science: What, why, and how. https://doi.org/10.31234/ osf.io/ak6jr

    2017

  81. [89]

    J., BEST, N

    SPIEGELHALTER, D. J., BEST, N. G., CARLIN, B. P. and VAN DERLINDE, A. (2002). Bayesian measures of model complex- ity and fit.Journal of the Royal Statistical Society Series B: Statistical Methodology64583–639. https://doi.org/10.1111/ 1467-9868.00353

    2002

  82. [90]

    (2025).Automated Detection of Media Bias: From the Conceptualization of Media Bias to its Computational Classification

    SPINDE, T. (2025).Automated Detection of Media Bias: From the Conceptualization of Media Bias to its Computational Classification. Springer Vieweg Wiesbaden. https://doi.org/10. 1007/978-3-658-47798-1

    2025

  83. [91]

    and JONATHAN, P

    SANDO, K., WADA, R., ROHMER, J. and JONATHAN, P. (2024). Multivariate spatial and spatio-temporal models for ex- treme tropical cyclone seas.Ocean Engineering309. https: //doi.org/10.1016/j.oceaneng.2024.118365

    2024

  84. [92]

    and AIZAWA, A

    SPINDE, T., PLANK, M., KRIEGER, J.-D., RUAS, T., GIPP, B. and AIZAWA, A. (2021). Neural Media Bias Detection Us- ing Distant Supervision With BABE - Bias Annotations By Experts. InFindings of the Association for Computational Linguistics: EMNLP 2021. https://doi.org/10.18653/v...

    2021 doi

  85. [93]

    Y., EFTELIOGLU, E., TANG, X., GUNTURI, V

    SHEKHAR, S., JIANG, Z., ALI, R. Y., EFTELIOGLU, E., TANG, X., GUNTURI, V. M. and ZHOU, X. (2015). Spa- tiotemporal data mining: A computational perspective.ISPRS International Journal of Geo-Information42306–2338. https: //doi.org/10.3390/ijgi4042306

    2015 doi

  86. [94]

    M., PARMENTIER, B

    STAEUDLE, T. M., PARMENTIER, B. and POOS, J. J. (2024). Accounting for spatio-temporal distribution changes in size- structured abundance estimates for a data-limited stock of Raja clavata.ICES Journal of Marine Science811607–1619. https: //doi.org/10.1093/icesjms/fsae106

    2024 doi

  87. [95]

    R., MÜLLER, P

    STROUD, J. R., MÜLLER, P. and SANSÓ, B. (2001). Dynamic models for spatiotemporal data.Journal of the Royal Statistical Society Series B: Statistical Methodology63673–689. https: //doi.org/10.1111/1467-9868.00305

    2001

  88. [96]

    and SHEN, Q

    SUN, F., HAO, W., ZOU, A. and SHEN, Q. (2024). A survey on spatio-temporal series prediction with deep learning: taxonomy, applications, and future directions.Neural Computing and Ap- plications369919–9943. https://doi.org/10.1007/s00521-024- 09659-1

    2024 doi

  89. [97]

    and GIPP, B

    SPINDE, T., HINTERREITER, S., HAAK, F., RUAS, T., GIESE, H., MEUSCHKE, N. and GIPP, B. (2023). The me- dia bias taxonomy: A systematic literature review on the forms and automated detection of media bias.arXiv preprint arXiv:2312.16148. https://doi.org/10.48550/arXiv.2312.16148

    2023 doi arXiv

  90. [98]

    T., THINKHAMROP, K., SUTTIPRAPA, S., CLEMENTS, A

    TAM, L. T., THINKHAMROP, K., SUTTIPRAPA, S., CLEMENTS, A. C. A., WANGDI, K. and SUWANNA- TRAI, A. T. (2024). Bayesian spatio-temporal modelling of environmental, climatic, and socio-economic influ- ences on malaria in Central Vietnam.Malaria Journal23. https://doi.org/10.1186/...

    2024 doi

  91. [99]

    and DONNAY, K

    SPINDE, T., RICHTER, E., WESSEL, M., KULSHRESTHA, J. and DONNAY, K. (2023). What do Twitter comments tell about news article bias? Assessing the impact of news article bias on its perception on Twitter.Online Social Networks and Media 37-38100264. https://doi.org/10.1016/j.osn...

    2023

  92. [100]

    A., TESSEMA, Z

    TESEMA, G. A., TESSEMA, Z. T., HERITIER, S., STIR- LING, R. G. and EARNEST, A. (2023). A Systematic Review of Joint Spatial and Spatiotemporal Models in Health Research. International Journal of Environmental Research and Public Health20. https://doi.org/10.3390/ijerph20075295

    2023 doi

  93. [101]

    and LAURINI, M

    VALENTE, F. and LAURINI, M. (2021). Pre-harvest sugarcane burning: A statistical analysis of the environmental impacts of a regulatory change in the energy sector.Cleaner Engineering and Technology4. https://doi.org/10.1016/j.clet.2021.100255

    2021

  94. [102]

    and UGARTE, M

    VICENTE, G., GOICOA, T. and UGARTE, M. D. (2023). Mul- tivariate Bayesian spatio-temporal P-spline models to analyze crimes against women.Biostatistics24562–584. https://doi. org/10.1093/biostatistics/kxab042

    2023 doi

  95. [103]

    L., RICHARDS, D., ONG, J., RA- JARETHINAM, J., HASSIM, M

    SUN, H., DICKENS, B. L., RICHARDS, D., ONG, J., RA- JARETHINAM, J., HASSIM, M. E. E., LIM, J. T., CAR- RASCO, L. R., AIK, J., YAP, G., COOK, A. R. and NG, L. C. (2021). Spatio-temporal analysis of the main dengue vector populations in Singapore.Parasites and Vectors14. https: ...

    2021 doi

  96. [104]

    and LING, C

    WANG, K., ZHANG, Y., BAI, L., CHEN, Y. and LING, C. (2025). Spatio-temporal modelling of extreme low birth rates in U.S. counties.BMC Public Health25. https://doi.org/10.1186/ s12889-025-21686-8

    2025

  97. [105]

    TEPE, E. (2024). History, neighborhood, and proximity as fac- tors of land-use change: A dynamic spatial regression model. Environment and Planning B-Urban Analytics and City Science 517–22. https://doi.org/10.1177/23998083231164397

    2024 doi

  98. [106]

    WIKLE, C. K. (2003). Hierarchical models in environmental science.International Statistical Review71181–199. https:// doi.org/10.1111/j.1751-5823.2003.tb00192.x

    2003

  99. [107]

    WIKLE, C. K. (2015). Modern perspectives on statistics for spatio-temporal data.Wiley Interdisciplinary Reviews: Compu- tational Statistics786–98. https://doi.org/10.1002/wics.1341

    2015 doi

  100. [108]

    WIKLE, C. K. and ZAMMIT-MANGION, A. (2023). Statisti- cal deep learning for spatial and spatiotemporal data.Annual Review of Statistics and Its Application10247–270. https: //doi.org/10.1146/annurev-statistics-033021-112628

    2023 doi

  101. [109]

    and POVALA, J

    VOMFELL, L. and POVALA, J. (2023). (No) Spillovers in re- porting domestic abuse to police.Journal of the Royal Statisti- cal Society Series A-Statistics in Society186811–833. https: //doi.org/10.1093/jrsssa/qnad060

    2023 doi

  102. [110]

    and WU, Q

    YAN, S. and WU, Q. (2025). How does intra-city spatial struc- ture influence green economic efficiency? A nonlinear and spa- tial spillover perspective.Habitat International162. https: //doi.org/10.1016/j.habitatint.2025.103455

    2025

  103. [111]

    and PHILIP, S

    WANG, S., CAO, J. and PHILIP, S. Y. (2020). Deep learning for spatio-temporal data mining: A survey.IEEE transactions on knowledge and data engineering343681–3700. https://doi. org/10.1109/TKDE.2020.3025580 A SYSTEMATIC REVIEW OF SPATIO-TEMPORAL STATISTICAL MODELS25

    2020

  104. [112]

    and SAHU, S

    YIP, S., HIM, N., JAMIL, N., HE, D. and SAHU, S. (2022). Spatio-temporal detection for dengue outbreaks in the Central Region of Malaysia using climatic drivers at mesoscale and syn- optic scale.Climate Risk Management36. https://doi.org/10. 1016/j.crm.2022.100429

    2022

  105. [113]

    and BODE, N

    ZAOUCHE, M. and BODE, N. (2023). Bayesian spatio- temporal models for mapping urban pedestrian traffic.Jour- nal of Transport Geography111. https://doi.org/10.1016/j. jtrangeo.2023.103647

    2023

  106. [114]

    and CRESSIE, N

    ZHANG, B., LI, F., SANG, H. and CRESSIE, N. (2022). Infer- ring Changes in Arctic Sea Ice through a Spatio-Temporal Lo- gistic Autoregression Fitted to Remote-Sensing Data.Remote Sensing14. https://doi.org/10.3390/rs14235995

    2022 doi

  107. [115]

    K., ZAMMIT-MANGION, A

    WIKLE, C. K., ZAMMIT-MANGION, A. and CRESSIE, N. (2019).Spatio-temporal statistics with R. Chapman and Hall/CRC. https://doi.org/10.1201/9781351769723

    2019 doi

  108. [116]

    and REED, C

    ZHANG, Y., CHANG, H., IULIANO, A. and REED, C. (2025). A Bayesian spatial-temporal varying coefficients model for es- timating excess deaths associated with respiratory infections. Journal of the Royal Statistical Society Series A-Statistics in Society188843–858. https://doi.o...

    2025 doi

  109. [117]

    M., HARRIS, R

    YIN, X., AIKEN, J. M., HARRIS, R. and BAMBER, J. L. (2024). A Bayesian spatio-temporal model of COVID-19 spread in England.Scientific Reports14. https://doi.org/10. 1038/s41598-024-60964-0

    2024

  110. [121]

    L., RUMISHA, S

    ZHANG, S., AMRATIA, P., SYMONS, T. L., RUMISHA, S. F., KANG, S. Y., CONNELL, M., UUSIKU, P., KATOKELE, S., HAMUNYELA, J., NTUSI, N., SOROSES, W., MOYO, E., LUKUBWE, O., MAPONGA, C., LUCERO, D., GETH- ING, P. W. and CAMERON, E. (2024). High-resolution spatio- temporal risk mapp...

    2024 doi

  111. [123]

    and SUN, T

    ZHAO, M. and SUN, T. (2022). Dynamic spatial spillover effect of new energy vehicle industry policies on carbon emission of transportation sector in China.Energy Policy165. https://doi. org/10.1016/j.enpol.2022.112991

    2022

  112. [392]

    https://doi.org/10.1111/j.1467-9868.2008.00700.x

    2008

  113. [419]

    https://doi.org/10.1111/pirs.12726 22

    doi

  114. [1233]

    https://doi.org/10.1016/j.ijforecast.2020.07.002

    2020 doi

  115. [4884]

    https://doi.org/10.1111/acfi.12785

    doi

Pith tools

Reviewed August 4, 2026 · model on record in the stance chip above.