Pith. sign in

REVIEW 4 major objections 4 minor 117 references

An ALMA study of hub-filament systems II.Quiescent filaments converging towards highly dynamic hubs

T0 review · 4 major / 4 minor · reviewed 2026-08-08 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read Six infrared-dark hub-filament systems all show calm converging filaments feeding turbulent, multi-component hub centres, while the spread of fitted component velocities barely changes as clump mass grows twenty-fold.

desk verdict Strong, honest observational paper on hub-filament kinematics; the qualitative hub/filament dichotomy is credible, but the quantitative radial gradients need robustness checks against mwydyn's SNR threshold. read the letter →

arxiv 2608.05650 v1 pith:U25ABEWK submitted 2026-08-06 astro-ph.GA

Michael Anderson , Nicolas Peretto , Sarah E. Ragan , Andrew J. Rigby , Adam Avison , Ana Duarte-Cabral , Gary A. Fuller , Yancy L. Shirley
show 2 more authors
Alessio Traficante Gwenllian M. Williams
This is my paper · ORCID
classification astro-ph.GA
keywords hub-filamentsystemshigh-massstarformationinfrareddarkcloudsN2H+kinematicsmwydynhyperfinefittingdensegasvelocitydispersionALMAobservationsvirialratio
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper follows a companion study which found that a higher fraction of a clump's mass ends up in its most massive core in infrared-dark hubs than in infrared-bright clumps, and asks what dynamics make that possible. Using ALMA N$_2$H$^+$ (J=1-0) maps of six infrared-dark hub-filament systems, the authors aim to establish that the filaments feeding a hub are kinematically quiescent (narrow linewidths near the isothermal sound speed) while the hub centre is kinematically hot (more velocity components, broader lines, and higher total velocity dispersion). They also claim that the spread of centroid velocities is nearly the same across clumps spanning a factor of about 20 in mass, which simple free-fall collapse of uniform spheres does not predict. If right, the hub's dynamical complexity is generated locally by the mixing of gravity-driven multi-directional inflows rather than inherited from the clump's global mass, and the clump's global dynamical state, not its mass alone, helps set the mass of the most massive core.

What carries the argument

The central tool is mwydyn, a fully automated hyperfine line-fitting code that decomposes each N$_2$H$^+$ (J=1-0) spectrum into up to three velocity components, each modelled as a complete seven-component hyperfine multiplet with fitted peak intensity, centroid velocity, FWHM linewidth, and total opacity. Model selection uses the Bayesian Information Criterion with a threshold $\Delta\mathrm{BIC}=20$, and the code iteratively refits each spectrum starting from the parameters of neighbouring lower-BIC spectra, suppressing artificial discontinuities across the map. The derived per-pixel quantity $\sigma_{\rm kin}$ combines the intra-component linewidth with the integrated-intensity-weighted spread of component centroid velocities, turning the full spectral complexity into a single number that drives the radial trend analysis, the mass profiles, and the virial-ratio profiles.

What would settle it

Run the best available sphere-collapse and sheet-collapse simulations through radiative transfer to produce synthetic N$_2$H$^+$ (J=1-0) cubes at the same $\sim3''$ resolution and sensitivity, fit them with mwydyn, and compare the recovered centroid-velocity spreads and $\sigma_{\rm kin}$ radial profiles with the paper's Figures 4 and 7; if the spheres reproduce the mass-independent velocity spread, or if the fitter recovers kinematics different from the known input in optically thick hub spectra, the central claims fail. An observational cross-check is to refit the hub spectra with a model that drops the shared-linewidth assumption and treats self-absorption, or to map an optically thinner dense-gas tracer toward SDC335 and test whether the high component counts and broad linewidths persist.

Watch

Extended reading notes

Core claim

On the paper's own terms, the discovery is that all six infrared-dark hub-filament systems observed in N$_2$H$^+$ (J=1-0) show the same two-part kinematic structure. The filaments in the outskirts are quiescent, with fitted linewidths peaking near $0.6$ km s$^{-1}$, close to the isothermal sound speed, and only one velocity component in most spectra. Toward the hub centres the number of fitted components, the FWHM linewidths, and the combined velocity dispersion $\sigma_{\rm kin}$ all increase systematically with decreasing radius, and the total dispersion becomes dominated by the spread between components rather than by the width of any single component. The centroid-velocity distributions are very similar across the six clumps even though their masses span from about 285 to 4926 solar masses, whereas free-fall models of uniform spheres predict infall velocities growing from about 2 to 6 km s$^{-1}$ across that range. The authors interpret the hubs as sites where gravitationally driven, multi-directional inflows mix and randomise their flow directions, producing a dynamically hot centre fed by calm filaments, and they note that sharp filament-to-hub transitions in some sources are consistent with accretion shocks at the hub boundary. Weighing the data against free-falling-sphere and face-on-sheet configurations, the paper concludes that neither shape alone accounts for all six systems and that a mixture of 3D morphologies is likely.

Load-bearing premise

The radial kinematic trends that carry the central claim come from mwydyn's fitted linewidths and component counts, and those fits assume that each velocity component has a Gaussian opacity profile with a single shared linewidth, one excitation temperature, non-overlapping hyperfine multiplets, and a well-resolved source; where optical depth and self-absorption become significant toward the hub centres, as observed in SDC335, those assumptions can bias the fitted widths and component numbers, so a fitting artifact could masquerade as the claimed filament-to-hub dynamical transition.

Editorial extensions

If this is right

  • All six systems, from 285 to 4926 solar masses, show the same quiescent-filament to dynamic-hub configuration, making the two-part structure a generic property of infrared-dark hub-filament systems rather than a feature of one mass or luminosity class.
  • The mass-independent centroid-velocity spread runs counter to the simplest free-fall picture of uniform collapsing spheres, whose predicted infall velocities range from about 2 to 6 km s$^{-1}$ across the sample.
  • Virial ratios rise from bound values ($\alpha_{\rm vir} \lesssim 2$) in the filament region to unbound values ($\alpha_{\rm vir} \gtrsim 2$) toward the hub centres in every system.
  • The tentative anti-correlation between $f_{\rm MMC}$ and the global virial ratio connects the clump's dynamical state with the mass of its most massive core, suggesting that low-virial-ratio hubs concentrate clump mass into a single core more efficiently.
  • Sharp filament-to-hub transitions in some systems are consistent with accretion shocks at the hub boundary, while smoother transitions in others point to a mixture of 3D morphologies, possibly face-on sheets in some cases and spheres in others.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • If the centroid-velocity spread is genuinely mass-independent, the clump-scale gravitational potential is not setting the observed kinematics, and the common velocity scale would instead be imprinted by the mechanism that assembled the clouds or by the geometry of the inflows, something the six-source sample cannot yet distinguish.
  • The paper's own opacity concerns imply a testable prediction: an optically thinner dense-gas tracer toward SDC335's hub should return fewer and narrower components than mwydyn reports if self-absorption is inflating the fitted complexity.
  • A consequence the authors leave implicit is that inflow rates computed from hub-region linewidths would overestimate the mass accretion along filaments, since the filament gas itself is narrow and quiescent; accretion rates should be derived from filament kinematics instead.
  • The near-identical velocity distributions could partly be a selection effect, because sources chosen for clear hub-filament extinction morphology may be preferentially viewed face-on; adding orientation diagnostics or enlarging the sample would test whether the velocity-spread similarity persists in other viewing geometries.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

4 major / 4 minor

Summary. This paper presents ALMA 12m+7m+TP N2H+ (1-0) observations of six infrared-dark hub-filament systems previously studied in Paper I. The authors introduce and release mwydyn, an automated multi-component hyperfine line-fitting code, and apply it to over 180,000 spectra. The central claims are: (i) gas in the filaments is quiescent, with narrow linewidths and single components, while the hubs show systematically increased velocity dispersion and multi-component structure; (ii) the distributions of fitted centroid velocities are strikingly similar across clumps spanning roughly a factor of 20 in mass; and (iii) virial ratio profiles rise from bound-like values in the filaments to unbound-like values in the hubs. The paper discusses these findings in the context of 3D morphology (spheres vs sheets), gravitational inflows, and the mass of the most massive core.

Significance. If the kinematic dichotomy between quiescent filaments and dynamic hubs is real, this is an important observational constraint on how hub-filament systems assemble and feed high-mass star formation. The use of fully combined TP+7m+12m data, the homogeneous sample, and the publicly released automated fitting code are clear strengths. The mass-independent centroid velocity distribution, if robust, is a falsifiable result that challenges simple free-fall scaling expectations. However, the quantitative radial trends and virial ratio profiles rest on the completeness and fidelity of the mwydyn component fits, so the significance is conditional on the checks requested below.

major comments (4)
  1. [Appendix A (steps iii-iv); Section 4.1; Eq. (2); Fig. 7] The mwydyn acceptance criterion requires each fitted component to satisfy a peak SNR threshold (SNR>=10) and a Delta-BIC=20 improvement. Because the N2H+ integrated intensity declines toward the outskirts (see Section 4.1 and Figure 2), faint broad components in the filament regions will preferentially fall below these thresholds and be absent from the FWHM and Ncomp distributions. This is exactly the pattern claimed as the filament/hub dichotomy: narrow single components at large radii and broad multi-component fits toward bright hubs. The authors themselves note that brighter regions have larger linewidths, which is a natural signature of this selection effect. The raw PV diagrams (Figures 9 and G1) show real velocity structure but do not rule out faint broad pedestals. Please add a completeness/synthetic-injection study (e.g., inject synthetic Gaussian/hyperfine components of known FWHM, amplitude, and radial position into the observed cubes, recover them with mwydyn, and report the recovery fraction as a function of radius and SNR), and show the radial trends of FWHM and Ncomp under a lower detection threshold as a robustness check.
  2. [Appendix A (assumptions i-v); Appendix F; Section 4.3] The hyperfine fitting model assumes a single excitation temperature, Gaussian opacities, equal linewidths for all components, no multiplet overlap, and a well-resolved source. Toward the hub centres, especially in SDC335, the paper itself notes prominent self-absorption and a ring-like Ncomp structure (Section 4.3 and Appendix F). These effects can bias the fitted FWHM upward and alter component counts in the hubs, potentially amplifying the apparent filament/hub contrast. Please quantify this bias by fitting synthetic optically thick spectra and/or by comparing with an independent optically thinner tracer, and discuss how the radial gradients in Figures 7 and 11 would change under these corrections.
  3. [Section 4; Eq. (2); Figures 7 and 11] The radial sigma_kin profiles and virial ratio profiles are computed from mwydyn output parameters, but no per-fit uncertainties on the centroids, FWHMs, or component counts are reported. The error bars shown in Figure 7 are interquartile ranges of the pixel distributions, not measurement uncertainties; they do not capture fitting degeneracies or parameter covariances. Please provide parameter uncertainties (e.g., from the covariance matrices or a bootstrap resampling) and propagate them into sigma_kin and alpha_vir, so that the reader can assess whether the radial trends are significant compared to the fitting noise.
  4. [Section 4.1; Figure 4; Section 5.1] The claim that the centroid velocity distributions are 'remarkably similar' across clumps is currently supported only by visual inspection of KDEs. This claim is load-bearing for the argument against free-fall scaling in Section 5.1. Please add a quantitative comparison, such as two-sample Kolmogorov-Smirnov or Anderson-Darling tests, bootstrap confidence intervals on distribution widths, or a hierarchical model that accounts for the finite number of independent beams per clump.
minor comments (4)
  1. [Section 3] There is a typo: 'resolutipom' should be 'resolution' in the sentence about Herschel column density maps.
  2. [Section 5.1] Two typos: 'Assuming that the mass o the collapsing clump' should read 'mass of', and 'This is will be the focus' should read 'This will be the focus'.
  3. [Figure 10] The vertical axis label 'M (M )' is missing the solar-mass symbol; it should be 'M (M_sun)' or equivalent.
  4. [Section 5.3] The virial ratio profiles are computed with k_rho=2 for all clumps. Since the density profile index is an input assumption that affects the normalization of E_grav, please add a sensitivity test (e.g., k_rho=1.5 and 2.5) or state explicitly whether the qualitative rise of alpha_vir with radius is robust to this choice.

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity: the kinematic results are direct products of line fitting and independent mass calibration; self-citations are not load-bearing.

full rationale

The paper's central claims are summaries of direct observables: mwydyn fits N2H+(J=1-0) spectra and returns component centroids, linewidths, and component counts; the radial trends in Figures 6 and 7 are empirical distributions of these fit outputs. No equation defines the conclusion in terms of the inputs; Eq. (2) merely combines fitted quantities into a total dispersion measure. The mass scale is set by calibrating X_N2H+ against Herschel column densities (Eq. 1), which is a standard calibration, not a prediction built from the kinematics. The free-fall comparison (Figure 8) uses an external analytic model (Girichidis et al. 2014) with observationally motivated masses and radii, so it does not reduce to the fitted line parameters. The only significant self-citations (Paper I for core masses and distances) are external ALMA continuum and Herschel data products; the kinematic dichotomy between filaments and hubs does not depend on them. The SNR and BIC thresholds in mwydyn could cause a sensitivity bias against faint broad components in low-brightness outskirts, but this is a potential observational selection effect, not a by-construction equivalence: the paper contains no equation or fitting constraint that forces FWHM or Ncomp to increase toward the hub. The derivation chain is therefore self-contained and not circular.

Assumptions & free parameters 6 free parameters · 6 assumptions · 0 invented entities

The paper introduces no new physical particles, forces, or conserved quantities. Its quantitative results rest on fitted conversion factors, a hand-set maximum component number, a BIC threshold, and standard assumptions about the N2H+ hyperfine structure, dust opacity, and spherical collapse. The qualitative kinematic picture is more robust than the mass and virial ratio profiles, which carry the larger systematic burden.

free parameters (6)
  • X_N2H+ conversion factor = (0.55 +/- 0.12) x 10^22 cm^-2 K^-1 km^-1 s
    Linear fit of Herschel column density versus N2H+ integrated intensity (Eq. 1, Section 3); used to convert emission to column density and derive clump masses, mass profiles, and f_MMC.
  • N_H2,0 column density offset = varies per cloud, set at SNR~1 threshold
    Offset in the linear fit of Eq. (1), chosen as the median column density where the integrated intensity SNR~1; affects the zero-point of the N2H+ column density calibration.
  • Maximum number of fitted components (N_max_comp) = 3
    Chosen by hand in Appendix A to limit computation; caps the measured component counts in the most complex hub spectra and therefore shapes the N_comp radial trends.
  • Delta BIC threshold = 20
    Chosen threshold in Appendix A for accepting a higher-order multi-component model; determines how many velocity components are assigned to each spectrum, affecting all kinematic distributions.
  • Density profile power-law index k_rho = 2
    Assumed in Eq. (5) for the gravitational energy and virial ratio profiles (Section 5.3), following Williams et al. (2000); changes the absolute virial ratios.
  • Initial number density n0 = 3 x 10^2 cm^-3
    Assumed initial density for the free-fall infall velocity model in Appendix C; used in Section 5.1 to compare expected free-fall velocity ranges with observed line widths.
assumptions (6)
  • domain assumption All hyperfine components of N2H+ (1-0) share the same excitation temperature, Gaussian opacity profiles, identical linewidth, and do not overlap, and the source is well resolved.
    Appendix A lists these as the five assumptions of the hyperfine fitting method inherited from CLASS; likely violated in optically thick, blended hub spectra, and all fitted kinematics depend on them.
  • domain assumption N2H+ integrated intensity traces H2 column density linearly with a single conversion factor X_N2H+ per cloud.
    Used in Eq. (1) and Section 3 to convert emission to column density and masses; known to worsen at high column densities and with protostellar heating (Peretto et al. 2013), as the authors note.
  • domain assumption The six clumps are at distances 2.0 to 3.2 kpc and are undergoing global collapse like most IR-dark clumps.
    Distances from literature (Table 2); global collapse is assumed in Section 5.1 and used to motivate the free-fall model comparison.
  • domain assumption The spherical free-fall collapse model with constant mass and initial density n0=300 cm^-3 describes the clumps' infall.
    Used in Appendix C and Section 5.1 to predict free-fall velocity ranges; assumes spherical symmetry, mass conservation, and no accretion onto the clump.
  • domain assumption Herschel column density maps assume a dust-to-gas mass ratio of 1% and opacity law kappa_lambda = 10 (lambda/300 um)^-1.8 cm^2 g^-1.
    Section 2.3; the N_H2,0 and X_N2H+ calibration against N2H+ depend on these maps, so the column density and mass estimates inherit this assumption.
  • domain assumption A BIC improvement of Delta BIC=20 is required to accept a more complex velocity component model.
    Model selection rule in Appendix A; this threshold controls the number of components fitted and therefore the central N_comp radial trend.

how reviews work

0 comments
Cite this review

Pith. "Pith review of An ALMA study of hub-filament systems II.Quiescent filaments converging towards highly dynamic hubs." pith.science (2026). https://pith.science/paper/U25ABEWK

@misc{pith2026260805650,
  author       = {Pith},
  title        = {Pith review of: An ALMA study of hub-filament systems II.Quiescent filaments converging towards highly dynamic hubs},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/U25ABEWK}},
  note         = {Machine review of arXiv:2608.05650}
}
abstract

Hub-filament systems are networks of converging interstellar filaments, often with active star formation at their centres, that may play an important role in high-mass star formation. In Anderson et al. (2021) we found that the mass fraction that ends up in a clump's most massive core is significantly higher in IR-dark hubs than IR-bright clumps, suggesting that the most-massive cores form early on. Such early massive core formation requires large inflow rates and dynamically active IR-dark clumps. We now present N$_2$H$^+$(J=1-0) observations of six IR-dark hub-filament systems mapped with ALMA 12m+7m+TP at $\sim 3''$ resolution, to trace the kinematics of the dense gas. The data show intricate emission structures and complex spectra. To characterise their kinematics, we have developed mwydyn, a fully-automated, multiple velocity component, hyperfine line-fitting code. Our results reveal that the emission invariably consists of quiescent individual filaments in the outskirts that converge towards the hub centres where a systematic increase in velocity dispersion and number of components is observed. We also find that the distribution of centroid velocities is remarkably similar between clumps, despite spanning more than one order of magnitude in mass. We propose that our results are best explained by the mixing of gravitationally-driven multi-directional inflows, resulting in highly complex and dynamic hub centres. We also discuss the implications of the observed differentiated filament and hub gas kinematics in the context of the 3D morphology of hub-filament systems.

Figures

Figures reproduced from arXiv: 2608.05650 by the authors.

Figure 1
Figure 1. First and third rows: Spitzer 8µm images of the six IRDCs we observed with ALMA, showing prominent extinction features in a hub-filament system configuration. Below each Spitzer image is the corresponding ALMA combined 12m+7m+TP N2H + (1–0) integrated intensity images. The synthesised beam size of each image is shown in the lower left corner, the grey contour shows the extent of our ALMA fields. The orange contours … view at source ↗
Figure 2
Figure 2. Histogram of the integrated intensity of N2H + against column density derived from Herschel for each cloud. The integrated intensity maps were convolved and regridded to match the Herschel column density map resolution. The column density offset, 𝑁H2 ,0, is the column density at which we do not detect any N2H + emission in our maps. The orange line represents our best linear fit, see Eq. (1). six IRDCs, along with t… view at source ↗
Figure 3
Figure 3. Integrated intensity N2H + image of SDC326, with example spectra in black (numbered 1–6, with locations marked on the map), and their corresponding best fitting models produced by mwydyn in red. For models comprised of multiple velocity components, their constituent sub-models are shown in light red. The locations of the best fit velocity centroids are marked with dark red vertical bars. towards higher FWHM with inc… view at source ↗
Figures from the paper (8 more)
Figure 4
Figure 4. Figure 4: (top row) Distributions of fitted velocity centroids (left) and fitted FWHM (right) produced by mwydyn. (bottom row) The same as above, but with each value weighted by the integrated intensity of their respective submodel. The integrated intensity-weighted mean centroi…
Figure 5
Figure 5. Figure 5: 3D PPV Galactic longitude-latitude-𝑉LSR (𝑙, 𝑏, 𝑣) visualisation of the fit results produced by mwydyn for SDC326. The points are coloured by the best fit FWHM value. On the lower box surface is a 2D projection (𝑙, 𝑏) showing the number of fitted velocity components alo…
Figure 6
Figure 6. Figure 6: Left: N2H + integrated intensity images for each cloud, with Her￾schel column density contours superimposed. The contour values, in units of 1022 cm−2 , are [6.0, 6.5, 8.3, 11.1, 15.0] for SDC345, [5.0, 5.6, 7.3, 10.1, 14.0] for SDC338, [7.5, 9.0, 13.6, 21.3, 32.0] for…
Figure 7
Figure 7. Figure 7: Comparison across HFSs of the median velocity dispersions (top), and median total velocity dispersions (middle) calculated for each radial bin. The errorbars represent the interquartile range of the distributions shown in Figure E1. The bottom panel shows the ratio 𝜎ki…
Figure 8
Figure 8. Figure 8: Infall velocity evolution as a function of density (top) and time (bottom) for six spherically symmetric collapsing clumps with masses [300, 700, 1000, 1600, 3300, 5000] M⊙ and final radii [0.3, 0.7, 0.5, 0.4, 0.8, 0.9] pc, respectively. These values were chosen to be …
Figure 9
Figure 9. Figure 9: The left-hand panels show the integrated N2H + (J=1–0) intensity data for SDC326, with the orange line indicating the axis for which the PV-diagram was generated, which is shown in the right-hand panel. The vertical green lines on the right-hand-side plot approximately…
Figure 10
Figure 10. Figure 10: Enclosed mass within each contour level (see [PITH_FULL_IMAGE:figures/full_fig_p013_10.png]
Figure 11
Figure 11. Figure 11: Virial parameter (of each contour level), as a function of the equivalent radius (𝑅eq) of the outer boundary of that contour level. The upper panel shows the virial parameter calculated using the velocity dispersion 𝜎 only (𝛼vir), with the lower panel using 𝜎kin (𝛼 ∗ …

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

117 extracted references · 18 canonical work pages

  1. [1]

    doi:10.1051/0004-6361/202450321 , urldate =

    2024 , month = sep, journal =. doi:10.1051/0004-6361/202450321 , urldate =

    doi:10.1051/0004-6361/202450321 2024

  2. [2]

    Anderson, Michael and Peretto, Nicolas and Ragan, Sarah E and Rigby, Andrew J and Avison, Adam and. An. 2021 , month = oct, journal =. doi:10.1093/mnras/stab2674 , urldate =

    doi:10.1093/mnras/stab2674 2021

  3. [3]

    The Initial Conditions of Star Formation in the

    Andr. The Initial Conditions of Star Formation in the. 2007 , month = sep, journal =. doi:10.1051/0004-6361:20077422 , urldate =

    work page doi:10.1051/0004-6361:20077422 2007

  4. [4]

    and Furuya, R

    Arzoumanian, D. and Furuya, R. S. and Hasegawa, T. and Tahani, M. and Sadavoy, S. and Hull, C. L. H. and Johnstone, D. and Koch, P. M. and Inutsuka, S. and Doi, Y. and Hoang, T. and Onaka, T. and Iwasaki, K. and Shimajiri, Y. and Inoue, T. and Peretto, N. and Andr. Dust Polarized Emission Observations of. 2021 , month = mar, journal =. doi:10.1051/0004-63...

    doi:10.1051/0004-6361/202038624 2021

  5. [5]

    2013 , month = oct, journal =

    Astropy:. 2013 , month = oct, journal =. doi:10.1051/0004-6361/201322068 , adsnote =. arXiv , eid =:1307.6212 , primaryclass =

    arXiv 2013

  6. [6]

    2018 , month = sep, journal =

    The Astropy Project:. 2018 , month = sep, journal =. doi:10.3847/1538-3881/aabc4f , adsnote =. arXiv , eid =:1801.02634 , primaryclass =

    arXiv 2018

  7. [7]

    2022 , month = aug, journal =

    The. 2022 , month = aug, journal =. doi:10.3847/1538-4357/ac7c74 , urldate =

    doi:10.3847/1538-4357/ac7c74 2022

  8. [8]

    and Peretto, N

    Avison, A. and Peretto, N. and Fuller, G. A. and. Tightening the Belt:. 2015 , month = may, journal =. doi:10.1051/0004-6361/201425041 , urldate =

    work page doi:10.1051/0004-6361/201425041 2015

Show all 117 references
  1. [9]

    and Fuller, G

    Avison, A. and Fuller, G. A. and Peretto, N. and. Continuity of Accretion from Clumps to. 2021 , month = jan, journal =. doi:10.1051/0004-6361/201936043 , urldate =

    2021 doi

  2. [10]

    2015 , month = nov, journal =

    Star Formation Triggered by Cloud-Cloud Collisions , author =. 2015 , month = nov, journal =. doi:10.1093/mnras/stv1772 , urldate =

    2015 doi

  3. [11]

    2017 , month = mar, journal =

    Star Formation Triggered by Non-Head-on Cloud--Cloud Collisions, and Clouds with Pre-Collision Sub-Structure , author =. 2017 , month = mar, journal =. doi:10.1093/mnras/stw2956 , urldate =

    2017 doi

  4. [12]

    2018 , month = jun, journal =

    Gravity or Turbulence?. 2018 , month = jun, journal =. doi:10.1093/mnras/sty1515 , urldate =

    2018 doi

  5. [13]

    2020 , month = sep, journal =

    Barnes, A T and Kauffmann, J and Bigiel, F and Brinkmann, N and Colombo, D and Guzm. 2020 , month = sep, journal =. doi:10.1093/mnras/staa1814 , urldate =

    2020 doi

  6. [14]

    Cloud-Cloud Collision as Origin of the

    Beltr. Cloud-Cloud Collision as Origin of the. 2022 , month = apr, journal =. doi:10.1051/0004-6361/202243361 , urldate =

    2022 doi

  7. [15]

    and Alves, Jo

    Bergin, Edwin A. and Alves, Jo. N[. 2002 , month = may, journal =. doi:10.1086/340950 , urldate =

    2002 doi

  8. [16]

    and Tafalla, Mario , year =

    Bergin, Edwin A. and Tafalla, Mario , year =. Cold. Annual Review of Astronomy and Astrophysics , volume =. doi:10.1146/annurev.astro.45.071206.100404 , urldate =

  9. [17]

    1992 , month = aug, journal =

    Pressure-Confined Clumps in Magnetized Molecular Clouds , author =. 1992 , month = aug, journal =. doi:10.1086/171638 , urldate =

    1992 doi

  10. [18]

    and Bontemps, S

    Bonne, L. and Bontemps, S. and Schneider, N. and Clarke, S. D. and Arzoumanian, D. and Fukui, Y. and Tachihara, K. and Csengeri, T. and Guesten, R. and Ohama, A. and Okamoto, R. and Simon, R. and Yahia, H. and Yamamoto, H. , year =. Formation of the. Astronomy & Astrophysics ,...

    doi

  11. [19]

    and Clark, Paul and Bate, Matthew R

    Bonnell, Ian A. and Clark, Paul and Bate, Matthew R. , year =. Gravitational Fragmentation and the Formation of Brown Dwarfs in Stellar Clusters:. Monthly Notices of the Royal Astronomical Society , volume =. doi:10.1111/j.1365-2966.2008.13679.x , urldate =

  12. [20]

    and Smith, Rowan J

    Bonnell, Ian A. and Smith, Rowan J. and Clark, Paul C. and Bate, Matthew R. , year =. The Efficiency of Star Formation in Clustered and Distributed Regions:. Monthly Notices of the Royal Astronomical Society , volume =. doi:10.1111/j.1365-2966.2010.17603.x , urldate =

  13. [21]

    , year =

    Briggs, Daniel S. , year =. High

  14. [22]

    2013 , month = feb, journal =

    Busquet, Gemma and Zhang, Qizhou and Palau, Aina and Liu, Hauyu Baobab and. 2013 , month = feb, journal =. doi:10.1088/2041-8205/764/2/L26 , urldate =

    2013 doi

  15. [23]

    and Myers, P

    Caselli, P. and Myers, P. C. and Thaddeus, P. , year =. Radio-Astronomical. The Astrophysical Journal , volume =. doi:10.1086/309805 , urldate =

    doi

  16. [24]

    and Myers, Philip C

    Caselli, Paola and Benson, Priscilla J. and Myers, Philip C. and Tafalla, Mario , year =. Dense. The Astrophysical Journal , volume =. doi:10.1086/340195 , urldate =

    doi

  17. [25]

    and Friesen, Rachel K

    Chen, Michael Chun-Yuan and Francesco, James Di and Rosolowsky, Erik and Keown, Jared and Pineda, Jaime E. and Friesen, Rachel K. and Caselli, Paola and Chen, How-Huan and Matzner, Christopher D. and Offner, Stella S. and Punanova, Anna and Redaelli, Elena and Scibelli, Samant...

    doi

  18. [26]

    and Caselli, Paola and Offner, Stella S

    Choudhury, Spandan and Pineda, Jaime E. and Caselli, Paola and Offner, Stella S. R. and Rosolowsky, Erik and Friesen, Rachel K. and Redaelli, Elena and. Transition from Coherent Cores to Surrounding Cloud in. 2021 , month = apr, journal =. doi:10.1051/0004-6361/202039897 , urldate =

    2021 doi

  19. [27]

    and Meade, Marilyn R

    Churchwell, Ed and Babler, Brian L. and Meade, Marilyn R. and Whitney, Barbara A. and Benjamin, Robert and Indebetouw, Remy and Cyganowski, Claudia and Robitaille, Thomas P. and Povich, Matthew and Watson, Christer and Bracker, Steve , year =. The. Publications of the Astronom...

    doi

  20. [28]

    2017 , month = jun, journal =

    Filamentary Fragmentation in a Turbulent Medium , author =. 2017 , month = jun, journal =. doi:10.1093/mnras/stx637 , urldate =

    2017 doi

  21. [29]

    Synthetic

    Clarke, S D and Whitworth, A P and Spowage, R L and. Synthetic. 2018 , month = sep, journal =. doi:10.1093/mnras/sty1675 , urldate =

    2018 doi

  22. [30]

    2021 , month = jun, doi =

    Comrie, Angus and. 2021 , month = jun, doi =

    2021

  23. [31]

    , year =

    Cornwell, Tim J. , year =. Multiscale. IEEE Journal of Selected Topics in Signal Processing , volume =. doi:10.1109/JSTSP.2008.2006388 , urldate =

    2008

  24. [32]

    and Bontemps, S

    Csengeri, T. and Bontemps, S. and Wyrowski, F. and Motte, F. and Menten, K. M. and Beuther, H. and Bronfman, L. and Commer. 2017 , month = apr, journal =. doi:10.1051/0004-6361/201629754 , urldate =

    2017 doi

  25. [33]

    Dewangan, L. K. and Ojha, D. K. and Baug, T. , year =. Hub-Filament. The Astrophysical Journal , volume =. doi:10.3847/1538-4357/aa79a5 , urldate =

    doi

  26. [34]

    Publications of the Astronomical Society of the Pacific , volume =

    Estalella, Robert , year =. Publications of the Astronomical Society of the Pacific , volume =. doi:10.1088/1538-3873/129/972/025003 , urldate =

    doi

  27. [35]

    On the Universality of Interstellar Filaments: Theory Meets Simulations and Observations , shorttitle =

    Federrath, Christoph , year =. On the Universality of Interstellar Filaments: Theory Meets Simulations and Observations , shorttitle =. Monthly Notices of the Royal Astronomical Society , volume =. doi:10.1093/mnras/stv2880 , urldate =

    doi

  28. [36]

    and Walch, S

    Ganguly, S. and Walch, S. and Clarke, S. D. and Seifried, D. , year =. arXiv e-prints , publisher =. doi:10.48550/ARXIV.2204.02511 , urldate =

    doi arXiv

  29. [37]

    Pyspeckit:

    Ginsburg, Adam and Sokolov, Vlas and. Pyspeckit:. 2022 , month = jun, journal =. doi:10.3847/1538-3881/ac695a , urldate =

    2022 doi

  30. [38]

    and Klessen, Ralf S

    Girichidis, Philipp and Konstandin, Lukas and Whitworth, Anthony P. and Klessen, Ralf S. , year =. On the. The Astrophysical Journal , volume =. doi:10.1088/0004-637X/781/2/91 , urldate =

    doi

  31. [39]

    Filaments in

    G. Filaments in. 2014 , month = aug, journal =. doi:10.1088/0004-637X/791/2/124 , urldate =

    2014 doi

  32. [40]

    and Montgomery, Jr., J

    Green, S. and Montgomery, Jr., J. A. and Thaddeus, P. , year =. Tentative Identification of. The Astrophysical Journal , volume =. doi:10.1086/181639 , urldate =

    doi

  33. [41]

    and Tafalla, M

    Hacar, A. and Tafalla, M. and Forbrich, J. and Alves, J. and Meingast, S. and Grossschedl, J. and Teixeira, P. S. , year =. An. Astronomy & Astrophysics , volume =. doi:10.1051/0004-6361/201731894 , urldate =

    doi

  34. [42]

    and Millman, K

    Harris, Charles R. and Millman, K. Jarrod and. Array Programming with. 2020 , month = sep, journal =. doi:10.1038/s41586-020-2649-2 , urldate =

    2020 doi

  35. [43]

    Henshaw, J. D. and Longmore, S. N. and Kruijssen, J. M. D. and Davies, B. and Bally, J. and Barnes, A. and Battersby, C. and Burton, M. and Cunningham, M. R. and Dale, J. E. and Ginsburg, A. and Immer, K. and Jones, P. A. and Kendrew, S. and Mills, E. A. C. and Molinari, S. an...

  36. [44]

    2020 , month = jul, journal =

    Ubiquitous Velocity Fluctuations throughout the Molecular Interstellar Medium , author =. 2020 , month = jul, journal =. doi:10.1038/s41550-020-1126-z , urldate =

    2020 doi

  37. [45]

    , year =

    Hunter, John D. , year =. Matplotlib:. Computing in Science & Engineering , volume =. doi:10.1109/MCSE.2007.55 , urldate =

    2007 doi

  38. [46]

    and Petry, Dirk and Barkats, Denis and Corder, Stuartt and Indebetouw, Remy , year =

    Hunter, Todd R. and Petry, Dirk and Barkats, Denis and Corder, Stuartt and Indebetouw, Remy , year =. doi:10.5281/ZENODO.7502160 , urldate =

    doi

  39. [47]

    2018 , month = may, journal =

    The Formation of Massive Molecular Filaments and Massive Stars Triggered by a Magnetohydrodynamic Shock Wave , author =. 2018 , month = may, journal =. doi:10.1093/pasj/psx089 , urldate =

    2018 doi

  40. [48]

    The Formation and Destruction of Molecular Clouds and Galactic Star Formation:

    Inutsuka, Shu-ichiro and Inoue, Tsuyoshi and Iwasaki, Kazunari and Hosokawa, Takashi , year =. The Formation and Destruction of Molecular Clouds and Galactic Star Formation:. Astronomy & Astrophysics , volume =. doi:10.1051/0004-6361/201425584 , urldate =

    doi

  41. [49]

    Joye, W. A. and Mandel, E. , editor =. New Features of. Astronomical Data Analysis Software and Systems. 2003 , month = jan, series =

    2003

  42. [50]

    , year =

    Kauffmann, Jens and Pillai, Thushara and Goldsmith, Paul F. , year =. The Astrophysical Journal , volume =. doi:10.1088/0004-637X/779/2/185 , urldate =

    doi

  43. [51]

    and Bourke, Tyler L

    Kirk, Helen and Myers, Philip C. and Bourke, Tyler L. and Gutermuth, Robert A. and Hedden, Abigail and Wilson, Grant W. , year =. Filamentary. The Astrophysical Journal , volume =. doi:10.1088/0004-637X/766/2/115 , urldate =

    doi

  44. [52]

    Kumar, M. S. N. and Palmeirim, P. and Arzoumanian, D. and Inutsuka, S. I. , year =. Unifying Low- and High-Mass Star Formation through Density-Amplified Hubs of Filaments. Astronomy and Astrophysics , volume =. doi:10.1051/0004-6361/202038232 , urldate =

    doi

  45. [53]

    Formation of a Protocluster:

    Lee, Yueh-Ning and Hennebelle, Patrick , year =. Formation of a Protocluster:. Astronomy & Astrophysics , volume =. doi:10.1051/0004-6361/201527981 , urldate =

    doi

  46. [54]

    Formation of a Protocluster:

    Lee, Yueh-Ning and Hennebelle, Patrick , year =. Formation of a Protocluster:. Astronomy & Astrophysics , volume =. doi:10.1051/0004-6361/201527982 , urldate =

    doi

  47. [55]

    Li, Zhi-Yun and Nakamura, Fumitaka , year =. Cluster. The Astrophysical Journal , volume =. doi:10.1086/503419 , urldate =

    doi

  48. [56]

    , year =

    Li, Di and Goldsmith, Paul F. , year =. The Astrophysical Journal , volume =. doi:10.1088/0004-637X/756/1/12 , urldate =

    doi

  49. [57]

    Fragmentation and

    Liu, Hauyu Baobab and. Fragmentation and. 2012 , month = sep, journal =. doi:10.1088/0004-637X/756/1/10 , urldate =

    2012 doi

  50. [58]

    Monthly Notices of the Royal Astronomical Society , volume =

    Liu, Tie and Evans, Neal J and Kim, Kee-Tae and Goldsmith, Paul F and Liu, Sheng-Yuan and Zhang, Qizhou and Tatematsu, Ken'ichi and Wang, Ke and Juvela, Mika and Bronfman, Leonardo and Cunningham, Maria R and Garay, Guido and Hirota, Tomoya and Lee, Jeong-Eun and Kang, Sung-Ju...

  51. [59]

    2023 , month = may, journal =

    Evidence of High-Mass Star Formation through Multiscale Mass Accretion in Hub-Filament-System Clouds , author =. 2023 , month = may, journal =. doi:10.1093/mnras/stad047 , urldate =

    2023 doi

  52. [60]

    McMullin, J. P. and Waters, B. and Schiebel, D. and Young, W. and Golap, K. , editor =. Astronomical. 2007 , month = oct, series =

    2007

  53. [61]

    and Schisano, E

    Molinari, S. and Schisano, E. and Elia, D. and Pestalozzi, M. and Traficante, A. and Pezzuto, S. and Swinyard, B. M. and. Hi-. 2016 , month = jul, journal =. doi:10.1051/0004-6361/201526380 , urldate =

    2016 doi

  54. [62]

    , year =

    Myers, Philip C. , year =. Filamentary. The Astrophysical Journal , volume =. doi:10.1088/0004-637X/700/2/1609 , urldate =

    doi

  55. [63]

    Magnetically

    Nakamura, Fumitaka and Li, Zhi-Yun , year =. Magnetically. The Astrophysical Journal , volume =. doi:10.1086/591641 , urldate =

    doi

  56. [64]

    and Ingargiola, Antonino , year =

    Newville, Matthew and Stensitzki, Till and Allen, Daniel B. and Ingargiola, Antonino , year =. doi:10.5281/ZENODO.11813 , urldate =

    doi

  57. [65]

    Lmfit/Lmfit-Py: 1.1.0 , shorttitle =

    Newville, Matt and Otten, Renee and Nelson, Andrew and Stensitzki, Till and Ingargiola, Antonino and Allan, Dan and Fox, Austin and Carter, Faustin and Micha. Lmfit/Lmfit-Py: 1.1.0 , shorttitle =. 2022 , month = nov, doi =

    2022

  58. [66]

    2016 , month = apr, journal =

    Padoan, Paolo and Pan, Liubin and Haugb. 2016 , month = apr, journal =. doi:10.3847/0004-637X/822/1/11 , urldate =

    2016 doi

  59. [67]

    Padoan, Paolo and Pan, Liubin and Juvela, Mika and Haugb. The. 2020 , month = sep, journal =. doi:10.3847/1538-4357/abaa47 , urldate =

    2020 doi

  60. [68]

    Penston, M. V. , year =. Dynamics of. Monthly Notices of the Royal Astronomical Society , volume =. doi:10.1093/mnras/144.4.425 , urldate =

    doi

  61. [69]

    and Andr

    Peretto, N. and Andr. Probing the Formation of Intermediate- to High-Mass Stars in Protoclusters:. 2006 , month = jan, journal =. doi:10.1051/0004-6361:20053324 , urldate =

    2006 doi

  62. [70]

    and Fuller, G

    Peretto, N. and Fuller, G. A. , year =. The Initial Conditions of Stellar Protocluster Formation:. Astronomy & Astrophysics , volume =. doi:10.1051/0004-6361/200912127 , urldate =

    doi

  63. [71]

    2013 , month = jul, journal =

    Global Collapse of Molecular Clouds as a Formation Mechanism for the Most Massive Stars , author =. 2013 , month = jul, journal =. doi:10.1051/0004-6361/201321318 , urldate =

    2013 doi

  64. [72]

    and Fuller, G

    Peretto, N. and Fuller, G. A. and Andr. 2014 , month = jan, journal =. doi:10.1051/0004-6361/201322172 , urldate =

    2014 doi

  65. [73]

    and Lenfestey, C

    Peretto, N. and Lenfestey, C. and Fuller, G. A. and Traficante, A. and Molinari, S. and Thompson, M. A. and. The Initial Conditions for Stellar Protocluster Formation:. 2016 , month = jun, journal =. doi:10.1051/0004-6361/201527064 , urldate =

    2016 doi

  66. [74]

    and Adam, R

    Peretto, N. and Adam, R. and Ade, P. and Ajeddig, H. and Andr. Galactic Star Formation with. 2022 , journal =. doi:10.1051/epjconf/202225700037 , urldate =

    2022

  67. [75]

    2023 , month = aug, journal =

    Star Cluster Progenitors Are Dynamically Decoupled from Their Parent Molecular Clouds , author =. 2023 , month = aug, journal =. doi:10.1093/mnras/stad2453 , urldate =

    2023 doi

  68. [76]

    2007 , month = may, journal =

    P. 2007 , month = may, journal =

    2007

  69. [77]

    Pety, J. Gildas. 2018 , month = mar, doi =

    2018

  70. [78]

    Priestley, F D and Clark, P C and Glover, S C O and Ragan, S E and Feh. Non-. 2023 , month = jul, journal =. doi:10.1093/mnras/stad2278 , urldate =

    2023 doi

  71. [79]

    2023 , month = oct, journal =

    Priestley, F D and Clark, P C and Glover, S C O and Ragan, S E and Feh. 2023 , month = oct, journal =. doi:10.1093/mnras/stad3089 , urldate =

    2023 doi

  72. [80]

    Ragan, S. E. and Bergin, E. A. and Plume, R. and Gibson, D. L. and Wilner, D. J. and O'Brien, S. and Hails, E. , year =. Molecular. The Astrophysical Journal Supplement Series , volume =. doi:10.1086/506594 , urldate =

    doi

  73. [81]

    and Heitsch, Fabian and Bergin, Edwin A

    Ragan, Sarah E. and Heitsch, Fabian and Bergin, Edwin A. and Wilner, David , year =. The Astrophysical Journal , volume =. doi:10.1088/0004-637X/746/2/174 , urldate =

    doi

  74. [82]

    and Henning, Thomas and Beuther, Henrik and Linz, Hendrik and Zahorecz, Sarolta , year =

    Ragan, Sarah E. and Henning, Thomas and Beuther, Henrik and Linz, Hendrik and Zahorecz, Sarolta , year =. Fragmentation and Kinematics of Dense Molecular Cores in the Filamentary Infrared-Dark Cloud. Astronomy & Astrophysics , volume =. doi:10.1051/0004-6361/201424948 , urldate =

    doi

  75. [83]

    and Kainulainen, J

    Riener, M. and Kainulainen, J. and Henshaw, J. D. and Orkisz, J. H. and Murray, C. E. and Beuther, H. , year =. Astronomy & Astrophysics , volume =. doi:10.1051/0004-6361/201935519 , urldate =

    doi

  76. [84]

    2024 , month = jan, journal =

    The Dynamic Centres of Infrared-Dark Clouds and the Formation of Cores , author =. 2024 , month = jan, journal =. doi:10.1093/mnras/stae030 , urldate =

    2024 doi

  77. [85]

    Rosolowsky, E. W. and Pineda, J. E. and Kauffmann, J. and Goodman, A. A. , year =. Structural. The Astrophysical Journal , volume =. doi:10.1086/587685 , urldate =

    doi

  78. [86]

    and Csengeri, T

    Schneider, N. and Csengeri, T. and Bontemps, S. and Motte, F. and Simon, R. and Hennebelle, P. and Federrath, C. and Klessen, R. , year =. Dynamic Star Formation in the Massive. Astronomy & Astrophysics , volume =. doi:10.1051/0004-6361/201014481 , urldate =

    doi

  79. [87]

    , year =

    Shirley, Yancy L. , year =. The. Publications of the Astronomical Society of the Pacific , volume =. doi:10.1086/680342 , urldate =

    doi

  80. [88]

    and Dalgarno, A

    Sternberg, A. and Dalgarno, A. , year =. Chemistry in. The Astrophysical Journal Supplement Series , volume =. doi:10.1086/192198 , urldate =

    doi

  81. [89]

    , year =

    Tafalla, M. , year =. Infall in. Astronomical Society of the Pacific , volume =

  82. [90]

    and Usero, A

    Tafalla, M. and Usero, A. and Hacar, A. , year =. Characterizing the Line Emission from Molecular Clouds:. Astronomy & Astrophysics , volume =. doi:10.1051/0004-6361/202346136 , urldate =

    doi

  83. [91]

    Taylor, M. B. , editor =. Astronomical Data Analysis Software and Systems. 2005 , month = dec, series =

    2005

  84. [92]

    and Turner, B

    Thaddeus, P. and Turner, B. E. , year =. Confirmation of Interstellar. The Astrophysical Journal , volume =. doi:10.1086/181932 , urldate =

    doi

  85. [93]

    and Fuller, G

    Traficante, A. and Fuller, G. A. and Smith, R. J. and Billot, N. and. Massive 70. 2018 , month = feb, journal =. doi:10.1093/mnras/stx2672 , urldate =

    2018 doi

  86. [94]

    Traficante, A and Jones, B M and Avison, A and Fuller, G A and Benedettini, M and Elia, D and Molinari, S and Peretto, N and Pezzuto, S and Pillai, T and Rygl, K L J and Schisano, E and Smith, R J , year =. The. Monthly Notices of the Royal Astronomical Society , volume =. doi...

    doi

  87. [95]

    2019 , month = sep, journal =

    Dynamics of Cluster-Forming Hub-Filament Systems:. 2019 , month = sep, journal =. doi:10.1051/0004-6361/201935260 , urldate =

    2019 doi

  88. [96]

    Magnetic Seismology of Interstellar Gas Clouds:

    Tritsis, Aris and Tassis, Konstantinos , year =. Magnetic Seismology of Interstellar Gas Clouds:. Science , volume =. doi:10.1126/science.aao1185 , urldate =

    doi

  89. [97]

    The Musca Molecular Cloud:

    Tritsis, A and Bouzelou, F and Skalidis, R and Tassis, K and En. The Musca Molecular Cloud:. 2022 , month = jun, journal =. doi:10.1093/mnras/stac1572 , urldate =

    2022 doi

  90. [98]

    Turner, B. E. , year =. U93.174 -. The Astrophysical Journal , volume =. doi:10.1086/181638 , urldate =

    doi

  91. [99]

    2014 , month = jun, journal =

    Scikit-Image: Image Processing in. 2014 , month = jun, journal =. doi:10.7717/peerj.453 , urldate =

    2014 doi

  92. [100]

    2019 , month = dec, journal =

    Global Hierarchical Collapse in Molecular Clouds. 2019 , month = dec, journal =. doi:10.1093/mnras/stz2736 , urldate =

    2019 doi

  93. [101]

    and Haberland, Matt and Reddy, Tyler and Cournapeau, David and Burovski, Evgeni and Peterson, Pearu and Weckesser, Warren and Bright, Jonathan and

    Virtanen, Pauli and Oliphant, Travis E. and Haberland, Matt and Reddy, Tyler and Cournapeau, David and Burovski, Evgeni and Peterson, Pearu and Weckesser, Warren and Bright, Jonathan and. 2020 , month = mar, journal =. doi:10.1038/s41592-019-0686-2 , urldate =

    2020 doi

  94. [102]

    Wang, Peng and Li, Zhi-Yun and Abel, Tom and Nakamura, Fumitaka , year =. Outflow. The Astrophysical Journal , volume =. doi:10.1088/0004-637X/709/1/27 , urldate =

    doi

  95. [103]

    Williams, J. P. and Blitz, L. and McKee, C. F. , editor =. The Structure and Evolution of Molecular Clouds: From Clumps to Cores to the. Protostars &. 2000 , month = may, pages =. doi:10.48550/arXiv.astro-ph/9902246 , keywords =

    doi arXiv

  96. [104]

    Williams, G. M. and Peretto, N. and Avison, A. and. Gravity Drives the Evolution of Infrared Dark Hubs:. 2018 , month = may, journal =. doi:10.1051/0004-6361/201731587 , urldate =

    2018 doi

  97. [105]

    Monthly Notices of the Royal Astronomical Society , volume =

    Williams, Thomas G and Watkins, Elizabeth J , year =. Monthly Notices of the Royal Astronomical Society , volume =. doi:10.1093/mnras/stae2130 , urldate =

    doi

  98. [106]

    2023 , month = feb, journal =

    Xu, Feng-Wei and Wang, Ke and Liu, Tie and Goldsmith, Paul F and Zhang, Qizhou and Juvela, Mika and Liu, Hong-Li and Qin, Sheng-Li and Li, Guang-Xing and Tej, Anandmayee and Garay, Guido and Bronfman, Leonardo and Li, Shanghuo and Wu, Yue-Fang and G. 2023 , month = feb, journa...

    2023 doi

  99. [107]

    Chemical

    Yu, Nai-Ping and Xu, Jin-Long and Wang, Jun-Jie and Liu, Xiao-Lan , year =. Chemical. The Astrophysical Journal , volume =. doi:10.3847/1538-4357/aadb94 , urldate =

    doi

  100. [108]

    2022 , month = jul, journal =

    Zhou, Jian-Wen and Liu, Tie and Evans, Neal J and Garay, Guido and Goldsmith, Paul F and G. 2022 , month = jul, journal =. doi:10.1093/mnras/stac1735 , urldate =

    2022 doi

  101. [109]

    The assembly of a star cluster: Dense N _ 2 H ^ + (1 0) kinematics in the massive G351.77 protocluster

    ALMA-IMF: XVIII. The assembly of a star cluster: Dense N _ 2 H ^ + (1 0) kinematics in the massive G351.77 protocluster. , keywords =. doi:10.1051/0004-6361/202452589 , archivePrefix =. 2410.09843 , primaryClass =

    arXiv

  102. [110]

    N _ 2 H ^ + kinematic analysis of the intermediate protocluster G353.41

    ALMA-IMF: XIII. N _ 2 H ^ + kinematic analysis of the intermediate protocluster G353.41. , keywords =. doi:10.1051/0004-6361/202450321 , archivePrefix =. 2404.07363 , primaryClass =

    arXiv

  103. [111]

    , keywords =

    Simulation of Head-on Collisions between Filamentary Molecular Clouds Threaded by a Lateral Magnetic Field and Subsequent Evolution. , keywords =. doi:10.3847/1538-4357/ace7bd , archivePrefix =. 2307.07698 , primaryClass =

    arXiv

  104. [112]

    Evolution of compressed clouds formed by filament coalescence. I. Oblique collisions. arXiv e-prints , keywords =. doi:10.48550/arXiv.2605.20835 , archivePrefix =. 2605.20835 , primaryClass =

    doi arXiv

  105. [113]

    , keywords =

    An Origin of Radially Aligned Filaments in Hub-filament Systems. , keywords =. doi:10.3847/2041-8213/ae4c84 , archivePrefix =. 2603.03063 , primaryClass =

  106. [114]

    From filaments to spheroids: the origin of the hub-filament systems

    Emergence of high-mass stars in complex fiber networks (EMERGE): V. From filaments to spheroids: the origin of the hub-filament systems. , keywords =. doi:10.1051/0004-6361/202450779 , archivePrefix =. 2411.05613 , primaryClass =

    arXiv

  107. [115]

    , keywords =

    Clouds, filaments, and protostars: The Herschel Hi-GAL Milky Way. , keywords =. doi:10.1051/0004-6361/201014659 , archivePrefix =. 1005.3317 , primaryClass =

    arXiv

  108. [116]

    , keywords =

    Multiscale dynamics in star-forming regions: the interplay between gravity and turbulence. , keywords =. doi:10.1093/mnras/stz3344 , archivePrefix =. 1912.00031 , primaryClass =

    1912 arXiv

  109. [117]

    , keywords =

    An inverted infall profile for the collapse of the massive star-forming IRDC SDC335.579-0.292. , keywords =. doi:10.1093/mnras/stag644 , archivePrefix =. 2603.30029 , primaryClass =

    arXiv

Pith tools

Reviewed August 8, 2026 · model on record in the stance chip above.