Pith. sign in

REVIEW 4 major objections 5 minor 6 cited by

A Hierarchy of Superconductivity and Topological Charge Density Wave States in Rhombohedral Graphene

T0 review · 4 major / 5 minor · reviewed 2026-08-06 · deepseek-v4-flash

Pith's one-line read In rhombohedral hexalayer graphene, an out-of-plane magnetic field stabilizes superconductivity that coexists with re-entrant integer quantum Hall states; the superconducting phase develops only after a zero-field stripe order is replaced…

desk verdict A field-stabilized superconductor coexisting with reentrant integer quantum Hall states in rhombohedral hexalayer graphene is a real and new transport result; the CDW parent-order interpretation is plausible but not uniquely established. read the letter →

arxiv 2507.22026 v3 pith:CUJU7XRQ submitted 2025-07-29 cond-mat.mes-hall cond-mat.str-elcond-mat.supr-con

classification cond-mat.mes-hallcond-mat.str-elcond-mat.supr-con
keywords rhombohedralhexalayergraphenesuperconductivityre-entrantintegerquantumHalleffectbubble-likechargedensitywavestripeorderfield-stabilizedtransportanisotropytopologicalCDW
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper reports that in moiré-less rhombohedral hexalayer graphene, an out-of-plane magnetic field does not destroy superconductivity but actively stabilizes it, and the superconducting phase coexists with a re-entrant integer quantum Hall effect. The authors interpret the re-entrant Hall states as the signature of a bubble-like charge density wave that persists across the entire phase-space region, and they argue this CDW is the parent order from which both superconductivity and the re-entrant quantum Hall states emerge. If the interpretation is right, it overturns the textbook mutual exclusivity of superconductivity and the quantum Hall effect and makes CDW order the enabling ingredient for field-stabilized superconductivity. The result matters because it identifies a concrete mechanism—replacing stripe order with bubble order—that turns a field-robust superconductor on.

What carries the argument

The central object is the bubble-like CDW—a periodic electronic texture that localizes a fraction of the carriers into insulating islands while leaving itinerant electrons in between. It is identified indirectly through re-entrant integer quantum Hall plateaus, whose re-entrant Hall response signals an effective reduction of carrier density, and through the suppression of transport anisotropy: angle-resolved measurements in a sunflower contact geometry show the zero-field stripe phase has $\sigma_{\max}/\sigma_{\min} \approx 10^3$, falling to about 2–4 at finite field, consistent with a weakly distorted bubble phase. The argument is carried by the coordinated temperature and current-bias fragility of the superconducting and RIQH states, which share the CDW melting transition, and by the mismatch between the quantized Hall plateaus and the Středa slopes of the RIQH trajectories, which the paper attributes to a malleable CDW whose localized fraction changes with density, field, and displacement field.

What would settle it

Direct local imaging (for example, scanning tunneling microscopy or a compressibility measurement) of rhombohedral hexalayer graphene inside regime I would settle the central claim: if no bubble-like periodic charge modulation is present, or if its melting temperature differs from the $\approx 0.4$ K onset shared by the superconducting and re-entrant quantum Hall responses, the parent-order interpretation fails.

Watch

Extended reading notes

Core claim

In rhombohedral hexalayer graphene without a moiré lattice, the paper claims, a perpendicular magnetic field $B_\perp$ stabilizes an unconventional superconducting phase up to $B_\perp > 4$ T, rather than suppressing it. The superconducting phase occupies the same density–displacement-field region where a stripe-ordered phase exists at zero field, but it only appears once the stripe order is replaced, at finite field, by a bubble-like CDW inferred from re-entrant integer quantum Hall states. In these RIQH states the Hall conductivity $\sigma_{xy}$ re-enters a distant integer plateau while $\sigma_{xx}$ vanishes, which the paper attributes to a CDW freezing part of the carriers and lowering the effective itinerant density. The superconducting and RIQH responses share a sharp onset near $T \approx 0.4$ K, the same melting scale for the CDW, and they compete at their boundary; together this is taken as evidence that the CDW is the parent order for both phases. The paper further notes that the regime-I boundaries trace a fractional Středa slope $t = 2.5$, hinting at nontrivial topology tied to the CDW.

Load-bearing premise

The whole story depends on reading certain electrical signatures as proof that electrons have arranged themselves into a repeating bubble pattern; that pattern has not been seen directly, and the same electrical data are used both to infer it and to explain why the magnetic-field slopes look unusual.

Editorial extensions

If this is right

  • The superconducting phase surviving to $B_\perp > 4$ T rules out ordinary $s$-wave pairing; the paper points to spin-triplet, odd-orbital ($p$-wave-like) pairing as the natural candidate.
  • Because the CDW melting temperature ($T \approx 0.4$ K) sets the onset of both superconductivity and the re-entrant quantum Hall states, any microscopic theory of this superconductivity must reproduce the CDW melting as the controlling scale.
  • Superconductivity and the re-entrant quantum Hall states compete: RIQH trajectories indent the superconducting boundary, so density, displacement field, and magnetic field can tune one against the other in the same device.
  • The fractional Středa slope $t = 2.5$ traced by the phase-boundary trajectories, if confirmed, connects the CDW order to physics conventionally associated with the $\nu = 5/2$ fractional quantum Hall state.
  • The same coexistence pattern reported in twisted transition-metal dichalcogenides suggests that unconventional superconductivity in two-dimensional flat-band systems is generically intertwined with a CDW parent order.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Inference: If the CDW is truly the parent order, the same crystal should support gate-defined superconducting/quantum-Hall junctions without an artificial interface, providing a natural platform for proximity topological superconductivity; the paper does not demonstrate this.
  • Inference: The reported tunability of the localized-carrier fraction with displacement field implies an electric-field-controlled switch that moves the system among stripe, bubble, superconducting, and re-entrant quantum Hall regimes at fixed magnetic field; this is a testable prediction not made explicitly in the paper.
  • Inference: A local probe that images the bubble lattice independently of transport—for example, scanning tunneling microscopy—would separate the CDW interpretation from alternatives such as a uniform correlated insulator that also reduces the effective carrier density.
  • Inference: The hierarchy (quarter metal → stripe/bubble CDW → superconductivity/RIQH) suggests that equivalent hexalayer devices with different layer counts should show the same bubble phase and a superconducting onset tied to its melting temperature, which would generalize the claim beyond this single sample.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

4 major / 5 minor

Summary. The paper reports transport measurements on moiré-less rhombohedral hexalayer graphene (R6G) showing that an out-of-plane magnetic field stabilizes a superconducting phase that coexists with re-entrant integer quantum Hall (RIQH) states. The authors interpret the RIQH states as evidence of a bubble-like charge density wave (CDW) that replaces the zero-field stripe order at finite field, and argue that this CDW is a parent order from which both RIQH and superconductivity emerge. The evidence for parentage includes a shared sharp onset temperature near 0.4 K, a continuous n–T envelope across regime I, comparable current sensitivity, and the suppression of transport anisotropy from ~10^3 to ~2–4. The paper further proposes that the relevant CDW orders are topologically nontrivial, based on hysteresis loops and a fractional Streda slope, and places the findings in a hierarchy of quarter-metal, stripe, bubble, and superconducting phases.

Significance. If the causal interpretation holds, this is a significant advance: it would be the first demonstration of a magnetic-field-stabilized superconductor coexisting with integer quantum Hall states in a single moiré-less two-dimensional system, and it would establish a CDW as a parent order for unconventional superconductivity, distinct from a pair-density-wave scenario. The direct transport signatures—vanishing Rxx and Rxy, reentrant Hall plateaus, and their systematic evolution with n, D, and B—appear internally consistent and are presented with care. The paper is also honest about open questions: it explicitly acknowledges the absence of a fully developed incompressible state, the ill-defined nature of the Streda slope, and the fact that the CDW is inferred rather than directly imaged. The main weakness is that the central causal claim—that a bubble-like CDW spans regime I and is responsible for superconductivity—is not uniquely determined by the transport data presented.

major comments (4)
  1. [Main text, paragraph after Fig. 2 ('The re-entrant Hall response...')] The identification of the re-entrant transport with a bubble-like CDW is load-bearing but indirect. The manuscript states that the effective density reduction is 'most naturally attributed to the formation of CDW order,' and later uses the same transport features both as evidence for the CDW and as the explanation for the Streda-slope mismatch (Fig. M3). Because R6G is a six-band system under large displacement field, a single-particle mechanism based on B- or D-dependent interband redistribution or Landau-level crossings could in principle produce reentrant plateaus and an effective density reduction without spontaneous symmetry breaking. The manuscript does not compare against such a model or provide an independent probe (e.g., local compressibility, STM, or a measurement that isolates a CDW gap). Please supply a concrete falsifiable test that distinguishes CDW from a multi-band single-particle scenario, or restrict the conclusions to the coexistence claim.
  2. [Main text, 'A natural interpretation...' after Fig. 3b] The causal claim that CDW order remains stable throughout regime I and serves as the parent order for superconductivity is not established. The shared T ≈ 0.4 K onset and continuous envelope in Figs. 3c–d are consistent with the proposed parentage, but they are equally consistent with two independent orders that share an interaction scale, or with a CDW confined to the RIQH trajectories. The loss of anisotropy (Fig. 3e) shows only that the stripe order is suppressed; it does not demonstrate that a bubble CDW persists throughout the superconducting region. To support parentage, the manuscript needs to show that the CDW order parameter exists across the entire regime I, or to soften the conclusion from 'decisive role' to 'consistent with a CDW backdrop.'
  3. [Methods, Fig. M3 and accompanying text] The Streda-slope analysis is a fit, not a parameter-free prediction. The fits align t with each RIQH trajectory, and the resulting half-integer slopes are then interpreted as evidence for CDW order. Because t is fitted to the very trajectories it is supposed to explain, the mismatch does not provide independent confirmation of the CDW. Moreover, the text states that 'a single set of Streda slopes ... appears to capture all RIQH states,' but the slopes in Fig. M3 range from t = 3.5 to 6.5 at D = 980 mV/nm and t = 4.0 to 6.5 at D = 1000 mV/nm, which are not a single set. Please clarify whether these are distinct fitted slopes and what constraint, if any, the CDW model imposes on their values. If no such constraint is available, the topological interpretation (fractional t = 2.5 for the regime I boundary) should be presented as speculative, which the text already partly does.
  4. [Main text, paragraph beginning 'Two key observations suggest...'] The hysteresis loops (Fig. M10) and field-dependent phase boundaries are offered as evidence of nontrivial topology. Hysteresis alone can arise from domain-wall pinning, metastable multi-domain transport, or contact effects, without implying an anomalous Hall effect from a Chern band. The paper also acknowledges that the absence of a fully developed incompressible state 'precludes a definitive identification' of the fractional slope. Since the hierarchy in Fig. 4c presents nontrivial topology as the primary level from which CDW orders inherit properties, this chain should be flagged as speculative or supported by zero-field Hall measurements with reversed field sweeps that isolate the anomalous contribution.
minor comments (5)
  1. [Main text, 'The is further supported...'] There is a typo: 'The is further supported' should be 'This is further supported.'
  2. [Methods, paragraph 'Next, we discuss the trajectories...'] The paragraph beginning 'Next, we discuss the trajectories of RIQH states across the n–B planes' is duplicated verbatim, with a typo 'sysmetamic' in the first instance. Remove the duplicate.
  3. [Fig. 3e and Fig. M8] Specify the density and displacement field at which the anisotropy ratio is measured, and state whether the same (n, D) point is followed as a function of B or whether a trajectory within regime I is used; this affects the interpretation of the ratio's decrease.
  4. [Methods, 'Angle-resolved transport measurement' and main text] The claim that the sample is moiré-free ('the sample shows no evidence of alignment...') is stated without details. Please describe the procedure, e.g., the absence of superlattice resistance peaks or of Landau-fan reconstruction signatures, so the reader can judge the strength of this premise.
  5. [Reference [40]] Reference [40] (Huang et al.) is an arXiv preprint. If it is load-bearing for the Streda-slope interpretation, indicate its status, provide a published version if available, or summarize the relevant formula in the text so the reader does not have to rely on an unpublished source.

Circularity Check

1 steps flagged · score 4.0 of 10

One supporting Streda-slope argument is circular because the CDW assumption anchors the fit and is then invoked to explain its output; the central transport observations remain direct and independent.

  1. fitted input called prediction [Methods, 'Fitting RIQH states with Streda slopes' (Fig. M3 caption); main text Streda-slope discussion]
    "The sequence of RIQH states is fit using Streda slopes extrapolated to the low-density side of regime I, where the effective density of itinerant electrons is expected to vanish. The fits are determined by aligning the Streda slope with the trajectory of each RIQH state. While this procedure captures the overall trajectories, it yields a series of half-integer Streda slopes, despite the Hall plateaus being quantized at integer multiples of h/e2. This mismatch can be naturally attributed to the presence of CDW order."

    The anchor for the Streda-slope fit is the claim that the itinerant-electron density 'is expected to vanish' at the low-density boundary of regime I. That expectation is itself a CDW-model assumption: it presupposes that CDW order localizes carriers so that the effective mobile density goes to zero there. The fit then produces half-integer Streda slopes, and those slopes are presented as a 'mismatch' that is 'naturally attributed to the presence of CDW order.' Thus the CDW hypothesis is an input to the fitting procedure and is then used to explain the output of that same procedure. The half-integer slopes are not an independent confirmation of CDW; they are partly constructed by the CDW-motivated choice of extrapolation anchor.

full rationale

The paper's headline observations are direct transport measurements: field-stabilized superconductivity with vanishing Rxx and Rxy, re-entrant integer quantum Hall plateaus, a shared sharp onset near T~0.4 K, and the collapse of transport anisotropy from ~10^3 to ~2-4. None of these is produced by fitting a parameter to the quantity it is said to predict, and the superconducting phase is not constructed from the CDW model. The main circularity risk is confined to a supporting argument: the Streda-slope 'mismatch' cited as evidence for CDW is obtained by anchoring the slope fit to a point where the itinerant density is assumed to vanish, which is itself a CDW assumption; the resulting slopes are then attributed to CDW. This is a genuine but partial circularity. The paper also invokes prior work by the same group for the zero-field stripe phase and SC i (ref. [7]) and for angle-resolved methods (refs. [41,55,56]), but those citations are not load-bearing for the new B-stabilized SC/RIQH claim, and the present manuscript independently shows the anisotropy. Underdetermination of the CDW interpretation (e.g., multi-band single-particle alternatives) is a correctness risk, not circularity. Overall, the central causal claim retains independent experimental content, so the score is moderate rather than high.

Assumptions & free parameters 1 free parameters · 5 assumptions · 1 invented entities

The central claim that a bubble-like CDW stabilizes superconductivity rests on a chain of interpretations (RIQH implies CDW; same melting T implies shared parent order; Streda mismatch is CDW-induced). Many of these are not measured directly but inferred from the same transport data, so the ledger counts the inferred CDW as an invented entity and the Streda slopes as fitted parameters.

free parameters (1)
  • Streda slopes t for RIQH trajectories = t = 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5
    In Fig. M3, the positions of RIQH states in the n-B plane are fit to lines of constant Streda slope. The fitted half-integer slopes (despite integer Hall plateaus) are then interpreted as evidence for a CDW-induced shift in itinerant density. This interpretation feeds into the claim that a bubble CDW underlies the phase space.
assumptions (5)
  • domain assumption The global conductivity matrix extracted via the model of Ref. [57] describes the angle-resolved transport in all phases.
    Angle-resolved data are fit to a uniform anisotropic conductivity tensor (Methods, Fig. M7). If the sample were inhomogeneous, the anisotropy ratios and the inferred stripe/bubble distinction could be incorrect.
  • domain assumption Re-entrant Hall plateaus with vanishing Rxx indicate an incompressible quantum Hall state with reduced itinerant carrier density.
    Used to identify RIQH states and to infer CDW formation (main text, Fig. 2). Standard interpretation in quantum Hall literature.
  • domain assumption The carrier-density reduction in RIQH states is caused by a charge density wave that localizes carriers, not by another mechanism (e.g., magnetic breakdown or valley polarization).
    Main text: 'most naturally attributed to the formation of CDW order.' This is central to the hierarchy claim.
  • ad hoc to paper The Streda formula and its modification for CDW states (as in Ref. [40]) can be applied to RIQH trajectories in this system.
    The mismatch between half-integer slopes and integer plateaus is attributed to CDW order, relying on a theoretical treatment of a related but different system (twisted MoTe2).
  • domain assumption Hysteresis in B sweeps is a signature of anomalous Hall effect / orbital ferromagnetism, implying nontrivial band topology.
    M10: hysteresis loops are interpreted as anomalous Hall effect, but no direct Chern number measurement is presented.
invented entities (1)
  • Bubble-like CDW order in moiré-less R6G
    purpose: Postulated parent order that localizes a fraction of carriers and from which both RIQH states and the B-stabilized superconductor emerge.
    Inferred from transport: suppression of anisotropy, re-entrant Hall plateaus, sharp melting transition at 0.4 K. No local probe directly images the CDW; its existence is not confirmed outside the model.

how reviews work

0 comments
Cite this review

Pith. "Pith review of A Hierarchy of Superconductivity and Topological Charge Density Wave States in Rhombohedral Graphene." pith.science (2026). https://pith.science/paper/CUJU7XRQ

@misc{pith2026250722026,
  author       = {Pith},
  title        = {Pith review of: A Hierarchy of Superconductivity and Topological Charge Density Wave States in Rhombohedral Graphene},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/CUJU7XRQ}},
  note         = {Machine review of arXiv:2507.22026}
}
read the original abstract

Superconductivity and the quantum Hall effect are conventionally regarded as mutually exclusive: superconductivity is suppressed by magnetic fields, whereas the quantum Hall effect relies on them. Here we report a striking exception, where an unconventional superconducting phase is stabilized by an out-of-plane magnetic field and coexists with a re-entrant integer quantum Hall (RIQH) effect in moir\'e-less rhombohedral hexalayer graphene. The re-entrant quantum Hall state, arising from a bubble-like charge density wave (CDW), provides a natural backdrop for the emergence of superconductivity. Angle-resolved transport reveals that the field-stabilized superconducting phase occupies the same density--displacement-field regime as a stripe-ordered phase at zero field, yet only develops once the stripe is replaced by a bubble-like CDW at finite field. These findings demonstrate a decisive role of CDW order in stabilizing superconductivity in rhombohedral graphene, establishing a new paradigm for the interplay between superconductivity and quantum Hall physics.

Figures

Figures reproduced from arXiv: 2507.22026 by the authors.

Figure 1
Figure 1. FIG. 1 [PITH_FULL_IMAGE:figures/full_fig_p002_1.png] view at source ↗
Figure 2
Figure 2. FIG. 2 [PITH_FULL_IMAGE:figures/full_fig_p003_2.png] view at source ↗
Figure 3
Figure 3. FIG. 3 [PITH_FULL_IMAGE:figures/full_fig_p004_3.png] view at source ↗
Figures from the paper (1 more)
Figure 4
Figure 4. Figure 4: FIG. 4 [PITH_FULL_IMAGE:figures/full_fig_p005_4.png]

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 6 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Exact models of chiral flat-band superconductors

    cond-mat.str-el 2025-08 conditional novelty 8.0 of 10

    For a single-flavor flat band with inversion symmetry, a local attraction between opposite-parity orbitals yields exact superconducting ground states, including topological pairing.

  2. Surface-Selective Probe of Spin-Triplet Superconductivity in Rhombohedral Graphene

    cond-mat.mes-hall 2026-08 conditional novelty 7.0 of 10

    A one-sided WS2 layer suppresses superconductivity in rhombohedral pentalayer graphene precisely when the pairing carriers are pushed toward it, providing evidence for spin-triplet pairing.

  3. Nematic Wigner crystals in rhombohedral multilayer graphene

    cond-mat.str-el 2026-07 conditional novelty 7.0 of 10

    Projected Hartree–Fock and time-dependent Hartree–Fock calculations predict a spontaneously C3-breaking (nematic) Wigner crystal that is locally stable in a region of the rhombohedral tetralayer graphene phase diagram.

  4. Rhombohedral Graphene: A Tale of Many Crystals

    cond-mat.str-el 2026-07 conditional novelty 6.0 of 10

    A Mexican-hat band dispersion in rhombohedral graphene is predicted to stabilize four electron-crystal phases—Wigner, nodal Wigner, self-doped 'phantom' crystal, and hole-lattice 'anticrystal'—mapped over density and ...

  5. Anomalous metal and superconducting phases in rhombohedral graphene

    cond-mat.mes-hall 2026-07 accept novelty 6.0 of 10

    Gate-tuned rhombohedral graphene hosts adjacent zero-resistance superconducting and finite-resistance anomalous-metal pockets with similar Tc but distinct critical fields, constraining extrinsic origins of anomalous metals.

  6. Competing Orders Driven by Wigner Crystal Phase in Rhombohedral Graphene

    cond-mat.mes-hall 2026-07 conditional novelty 5.0 of 10

    In pentalayer rhombohedral graphene, the insulating state beside chiral superconductivity is a Wigner crystal whose boundary continuously connects to magnetic-field-stabilized superconducting and reentrant quantum Hal...

Reference graph

Works this paper leans on

59 extracted references · 49 canonical work pages · cited by 6 Pith papers

  1. [1]

    Charge density wave in two-dimensional electron liquid in weak magnetic field,

    A. A. Koulakov, M. M. Fogler, and B. I. Shklovskii, “Charge density wave in two-dimensional electron liquid in weak magnetic field,” Phys. Rev. Lett.76, 499–502 (1996)

  2. [2]

    Evidence for an anisotropic state of two- dimensional electrons in high Landau levels,

    MP Lilly, KB Cooper, JP Eisenstein, LN Pfeiffer, and KW West, “Evidence for an anisotropic state of two- dimensional electrons in high Landau levels,” Physical Review Letters82, 394 (1999)

  3. [3]

    Anisotropic states of two-dimensional electron systems in high Landau levels: Effect of an in-plane magnetic field,

    M. P. Lilly, K. B. Cooper, J. P. Eisenstein, L. N. Pfeiffer, and K. W. West, “Anisotropic states of two-dimensional electron systems in high Landau levels: Effect of an in-plane magnetic field,” Phys. Rev. Lett.83, 824–827 (1999)

  4. [4]

    Com- petition between a fractional quantum Hall liquid and bubble and wigner crystal phases in the third Landau level,

    G. Gervais, L. W. Engel, H. L. Stormer, D. C. Tsui, K. W. Baldwin, K. W. West, and L. N. Pfeiffer, “Com- petition between a fractional quantum Hall liquid and bubble and wigner crystal phases in the third Landau level,” Phys. Rev. Lett.93, 266804 (2004)

  5. [5]

    Bertrand I Halperin and Jainendra K Jain,Fractional quantum Hall effects: New developments(World Scien- tific, 2020)

  6. [6]

    Resistivity anisotropy of quantum Hall stripe phases,

    Michael Sammon, Xiaojun Fu, Yi Huang, Michael A Zu- dov, Boris I Shklovskii, Geoff C Gardner, John D Wat- son, Michael J Manfra, Kirk W Baldwin, Loren N Pfeif- fer,et al., “Resistivity anisotropy of quantum Hall stripe phases,” Physical Review B100, 241303 (2019)

  7. [7]

    Striped superconductor in rhombohedral hexalayer graphene,

    Erin Morissette, Peiyu Qin, Hai-Tian Wu, Naiyuan J Zhang, Ron Q Nguyen, K Watanabe, T Taniguchi, and JIA Li, “Striped superconductor in rhombohedral hexalayer graphene,” arXiv preprint arXiv:2504.05129 (2025)

  8. [8]

    Stripe and bubble phases in quantum Hall systems,

    Michael M Fogler, “Stripe and bubble phases in quantum Hall systems,” inHigh Magnetic Fields: Applications in Condensed Matter Physics and Spectroscopy(Springer,

Show all 59 references
  1. [9]

    Insulating and fractional quantum Hall states in the first excited Landau level,

    J. P. Eisenstein, K. B. Cooper, L. N. Pfeiffer, and K. W. West, “Insulating and fractional quantum Hall states in the first excited Landau level,” Phys. Rev. Lett.88, 076801 (2002)

  2. [10]

    Micro- scopic theory of the reentrant integer quantum Hall effect in the first and second excited Landau levels,

    M. O. Goerbig, P. Lederer, and C. Morais Smith, “Micro- scopic theory of the reentrant integer quantum Hall effect in the first and second excited Landau levels,” Phys. Rev. B68, 241302 (2003)

  3. [11]

    Competition between quantum-liquid and electron-solid phases in intermediate Landau levels,

    M. O. Goerbig, P. Lederer, and C. Morais Smith, “Competition between quantum-liquid and electron-solid phases in intermediate Landau levels,” Phys. Rev. B69, 115327 (2004)

  4. [12]

    Electron correlation in the second Landau level: A competition between many nearly degenerate quantum phases,

    J. S. Xia, W. Pan, C. L. Vicente, E. D. Adams, N. S. Sullivan, H. L. Stormer, D. C. Tsui, L. N. Pfeiffer, K. W. Baldwin, and K. W. West, “Electron correlation in the second Landau level: A competition between many nearly degenerate quantum phases,” Phys. Rev. Lett.93, 176809 (2004)

  5. [13]

    Collective nature of the reen- trant integer quantum Hall states in the second Landau level,

    N. Deng, A. Kumar, M. J. Manfra, L. N. Pfeiffer, K. W. West, and G. A. Cs´ athy, “Collective nature of the reen- trant integer quantum Hall states in the second Landau level,” Phys. Rev. Lett.108, 086803 (2012)

  6. [14]

    Observation of reen- trant integer quantum Hall states in the lowest Landau level,

    Yang Liu, C. G. Pappas, M. Shayegan, L. N. Pfeiffer, K. W. West, and K. W. Baldwin, “Observation of reen- trant integer quantum Hall states in the lowest Landau level,” Phys. Rev. Lett.109, 036801 (2012)

  7. [15]

    Competing fractional quan- tum Hall and electron solid phases in graphene,

    Shaowen Chen, Rebeca Ribeiro-Palau, Kang Yang, Kenji Watanabe, Takashi Taniguchi, James Hone, Mark O. Go- 8 erbig, and Cory R. Dean, “Competing fractional quan- tum Hall and electron solid phases in graphene,” Phys. Rev. Lett.122, 026802 (2019)

  8. [16]

    High-temperature superconductivity,

    P. W. Phillips, E. La Nave, and E. Huang, “High-temperature superconductivity,” Nature Reviews Physics3, 454–473 (2021)

  9. [17]

    Extreme magnetic field-boosted su- perconductivity,

    Sheng Ran, I-Lin Liu, Yun Suk Eo, Daniel J. Campbell, Paul M. Neves, Wesley T. Fuhrman, Shanta R. Saha, Christopher Eckberg, Hyunsoo Kim, David Graf, Fe- dor Balakirev, John Singleton, Johnpierre Paglione, and Nicholas P. Butch, “Extreme magnetic field-boosted su- perconductiv...

  10. [18]

    Nearly ferromagnetic spin-triplet su- perconductivity,

    Sheng N. Ran, Christopher Eckberg, Qing-Ping Ding, Yuji Furukawa, Tristin Metz, Shanta R. Saha, I-Lin Liu, Mark Zic, Hyunsoo Kim, Johnpierre Paglione, and Nicholas P. Butch, “Nearly ferromagnetic spin-triplet su- perconductivity,” Science365, 684–687 (2019)

  11. [19]

    Un- conventional superconductivity in heavy fermion UTe 2,

    Dai Aoki, Georg Knebel, Kenji Ishida, Aur´ elien Pourret, Daniel Braithwaite, G´ erard Lapertot, Qun Niu, Marek Valiska, Hisatomo Harima, and Jacques Flouquet, “Un- conventional superconductivity in heavy fermion UTe 2,” Journal of the Physical Society of Japan88, 043702 (2019)

  12. [20]

    A review of UTe2 at high magnetic fields,

    S. K. Lewin, C. E. Frank, S. Ran, J. P. Paglione, and N. P. Butch, “A review of UTe2 at high magnetic fields,” Reports on Progress in Physics86(2023), 10.1088/1361- 6633/acfb93

  13. [21]

    Non-Abelian anyons and topological quantum computation,

    Chetan Nayak, Steven H. Simon, Ady Stern, Michael Freedman, and Sankar Das Sarma, “Non-Abelian anyons and topological quantum computation,” Reviews of Mod- ern Physics80, 1083–1159 (2008)

  14. [22]

    Majorana zero modes and topological quantum computation,

    Sankar Das Sarma, Michael Freedman, and Chetan Nayak, “Majorana zero modes and topological quantum computation,” npj Quantum Information1(2015)

  15. [23]

    Majorana fermions on the quantum Hall edge,

    Lucila Peralta Gavensky, Gonzalo Usaj, and C. Alejan- dro Balseiro, “Majorana fermions on the quantum Hall edge,” Physical Review Research2, 033218 (2020)

  16. [24]

    Topological phases with parafermions: Theory and blueprints,

    Jason Alicea and Paul Fendley, “Topological phases with parafermions: Theory and blueprints,” Annual Review of Condensed Matter Physics7, 119–139 (2016)

  17. [25]

    Supercur- rent in the quantum Hall regime,

    F. Amet, C. T. Ke, I. V. Borzenets, J. Wang, K. Watan- abe, T. Taniguchi, R. S. Deacon, M. Yamamoto, Y. Bomze, S. Tarucha, and G. Finkelstein, “Supercur- rent in the quantum Hall regime,” Science352, 966–969 (2016)

  18. [26]

    Inducing superconduct- ing correlation in quantum Hall edge states,

    Gil-Ho Lee, Kuan-Feng Huang, Dmitri K. Efetov, Di S. Wei, Sean Hart, Takashi Taniguchi, Kenji Watanabe, Amir Yacoby, and Philip Kim, “Inducing superconduct- ing correlation in quantum Hall edge states,” Nature Physics13, 693–698 (2017)

  19. [27]

    Andreev reflection in the fractional quantum Hall state,

    ¨Onder G¨ ul, Yuval Ronen, Seung Hwan Lee, Hassan Shapourian, Jonathan Zauberman, Young Hyun Lee, Kenji Watanabe, Takashi Taniguchi, Ashvin Vishwanath, Amir Yacoby, and Philip Kim, “Andreev reflection in the fractional quantum Hall state,” Physical Review X12, 021057 (2022)

  20. [28]

    Loss and deco- herence at the quantum Hall-superconductor interface,

    Lingfei Zhao, Zubair Iftikhar, Trevyn F. Q. Larson, Ethan G. Arnault, Kenji Watanabe, Takashi Taniguchi, Fran ¸ cois Amet, and Gleb Finkelstein, “Loss and deco- herence at the quantum Hall-superconductor interface,” Phys. Rev. Lett.131, 176604 (2023)

  21. [29]

    Competing zero- field Chern insulators in superconducting twisted bilayer graphene,

    Petr Stepanov, Ming Xie, Takashi Taniguchi, Kenji Watanabe, Xiaobo Lu, Allan H MacDonald, B An- drei Bernevig, and Dmitri K Efetov, “Competing zero- field Chern insulators in superconducting twisted bilayer graphene,” arXiv preprint arXiv:2012.15126 (2020)

  22. [30]

    Superconductivity and quantized anomalous Hall effect in rhombohedral graphene,

    Youngjoon Choi, Ysun Choi, Marco Valentini, Caitlin L Patterson, Ludwig FW Holleis, Owen I Sheekey, Hari Stoyanov, Xiang Cheng, Takashi Taniguchi, Kenji Watanabe,et al., “Superconductivity and quantized anomalous Hall effect in rhombohedral graphene,” Na- ture , 1–6 (2025)

  23. [31]

    Signatures of unconventional superconductivity near reentrant and fractional quantum anomalous Hall insulators,

    Fan Xu, Zheng Sun, Jiayi Li, Ce Zheng, Cheng Xu, Jingjing Gao, Tongtong Jia, Kenji Watanabe, Takashi Taniguchi, Bingbing Tong, Li Lu, Jinfeng Jia, Zhiwen Shi, Shengwei Jiang, Yuanbo Zhang, Yang Zhang, Shim- ing Lei, Xiaoxue Liu, and Tingxin Li, “Signatures of unconventional su...

  24. [32]

    Anyon superconductivity and plateau transitions in doped fractional quantum anomalous Hall insulators,

    Pavel A. Nosov, Zhaoyu Han, and Eslam Khalaf, “Anyon superconductivity and plateau transitions in doped fractional quantum anomalous Hall insulators,” arXiv preprint arXiv:2506.02108 (2025)

  25. [33]

    Microscopic mechanism of anyon superconductivity emerging from fractional Chern insulators,

    Fabian Pichler, Clemens Kuhlenkamp, Michael Knap, and Ashvin Vishwanath, “Microscopic mechanism of anyon superconductivity emerging from fractional Chern insulators,” arXiv preprint arXiv:2506.08000 (2025)

  26. [34]

    Doping a fractional quantum anomalous Hall insulator,

    Zhengyan Darius Shi and T. Senthil, “Doping a fractional quantum anomalous Hall insulator,” arXiv preprint arXiv:2409.20567 (2024), arXiv:2409.20567 [cond-mat.str-el]

  27. [35]

    Half-and quarter-metals in rhombohedral trilayer graphene,

    Haoxin Zhou, Tian Xie, Areg Ghazaryan, Tobias Holder, James R Ehrets, Eric M Spanton, Takashi Taniguchi, Kenji Watanabe, Erez Berg, Maksym Serbyn, et al., “Half-and quarter-metals in rhombohedral trilayer graphene,” Nature598, 429–433 (2021)

  28. [36]

    Superconductivity in rhom- bohedral trilayer graphene,

    Haoxin Zhou, Tian Xie, Takashi Taniguchi, Kenji Watan- abe, and Andrea F Young, “Superconductivity in rhom- bohedral trilayer graphene,” Nature598, 434–438 (2021)

  29. [37]

    Isospin magnetism and spin-polarized supercon- ductivity in Bernal bilayer graphene,

    Haoxin Zhou, Ludwig Holleis, Yu Saito, Liam Cohen, William Huynh, Caitlin L Patterson, Fangyuan Yang, Takashi Taniguchi, Kenji Watanabe, and Andrea F Young, “Isospin magnetism and spin-polarized supercon- ductivity in Bernal bilayer graphene,” Science375, 774– 778 (2022)

  30. [38]

    Signatures of chiral superconductivity in rhombohedral graphene,

    Xinyuan Han, Elliott Morissette, Cheng Zhang, Yin Lin, and Leo Yu Li, “Signatures of chiral superconductivity in rhombohedral graphene,” Nature617, 389–395 (2025)

  31. [39]

    Generalized Bardeen- Cooper-Schrieffer states and the proposed low- temperature phase of liquid He 3,

    P. W. Anderson and P. Morel, “Generalized Bardeen- Cooper-Schrieffer states and the proposed low- temperature phase of liquid He 3,” Physical Review 123, 1911–1934 (1961)

  32. [40]

    Apparent inconsistency between streda formula and Hall conductivity in reentrant integer quantum anomalous Hall effect in twisted MoTe2,

    Yi Huang, Seth Musser, Jihang Zhu, Yang-Zhi Chou, and Sankar Das Sarma, “Apparent inconsistency between streda formula and Hall conductivity in reentrant integer quantum anomalous Hall effect in twisted MoTe2,” arXiv preprint arXiv:2506.10965 (2025)

  33. [41]

    Observation of giant nonlinear Hall conductivity in Bernal bilayer graphene,

    Dmitry V Chichinadze, Naiyuan James Zhang, Jiang- Xiazi Lin, Xiaoyu Wang, Kenji Watanabe, Takashi Taniguchi, Oskar Vafek, and JIA Li, “Observation of giant nonlinear Hall conductivity in Bernal bilayer graphene,” arXiv preprint arXiv:2411.11156 (2024)

  34. [42]

    Second Landau level fractional quantum Hall effects in the Corbino geome- 9 try,

    B.A. Schmidt, K. Bennaceur, S. Bilodeau, G. Gervais, L.N. Pfeiffer, and K.W. West, “Second Landau level fractional quantum Hall effects in the Corbino geome- 9 try,” Solid State Communications217, 1 – 5 (2015)

  35. [43]

    Parent berry curva- ture and the ideal anomalous Hall crystal,

    Tixuan Tan and Trithep Devakul, “Parent berry curva- ture and the ideal anomalous Hall crystal,” Physical Re- view X14, 041040 (2024)

  36. [44]

    Anomalous Hall crystals in rhombo- hedral multilayer graphene. i. interaction-driven Chern bands and fractional quantum Hall states at zero mag- netic field,

    Junkai Dong, Taige Wang, Tianle Wang, Tomohiro Soejima, Michael P Zaletel, Ashvin Vishwanath, and Daniel E Parker, “Anomalous Hall crystals in rhombo- hedral multilayer graphene. i. interaction-driven Chern bands and fractional quantum Hall states at zero mag- netic field,” Ph...

  37. [45]

    Anomalous Hall crystals in rhombo- hedral multilayer graphene. ii. general mechanism and a minimal model,

    Tomohiro Soejima, Junkai Dong, Taige Wang, Tianle Wang, Michael P Zaletel, Ashvin Vishwanath, and Daniel E Parker, “Anomalous Hall crystals in rhombo- hedral multilayer graphene. ii. general mechanism and a minimal model,” Physical Review B110, 205124 (2024)

  38. [46]

    Stabil- ity of anomalous Hall crystals in multilayer rhombohedral graphene,

    Zhihuan Dong, Adarsh S. Patri, and T. Senthil, “Stabil- ity of anomalous Hall crystals in multilayer rhombohedral graphene,” Phys. Rev. B110, 205130 (2024)

  39. [47]

    Ex- tended quantum anomalous Hall effect in moir´ e struc- tures: Phase transitions and transport,

    Adarsh S. Patri, Zhihuan Dong, and T. Senthil, “Ex- tended quantum anomalous Hall effect in moir´ e struc- tures: Phase transitions and transport,” Phys. Rev. B 110, 245115 (2024)

  40. [48]

    Theory of quantum anomalous Hall phases in pentalayer rhom- bohedral graphene moir´ e structures,

    Zhihuan Dong, Adarsh S. Patri, and T. Senthil, “Theory of quantum anomalous Hall phases in pentalayer rhom- bohedral graphene moir´ e structures,” Phys. Rev. Lett. 133, 206502 (2024)

  41. [49]

    Ex- tended quantum anomalous hall states in graphene/hbn moir´ e superlattices,

    Zhengguang Lu, Tonghang Han, Yuxuan Yao, Zach Had- jri, Jixiang Yang, Junseok Seo, Lihan Shi, Shenyong Ye, Kenji Watanabe, Takashi Taniguchi, and Long Ju, “Ex- tended quantum anomalous hall states in graphene/hbn moir´ e superlattices,” Nature637, 1090–1095 (2025)

  42. [50]

    Magneto-oscillatory effects in two-dimensional systems with spin-orbit interaction,

    P. Stˇ reda and L. Smrˇ cka, “Magneto-oscillatory effects in two-dimensional systems with spin-orbit interaction,” Journal of Physics C: Solid State Physics16, L895–L900 (1983)

  43. [51]

    Observation of an even-denominator quantum number in the fractional quantum Hall effect,

    R. Willett, J. P. Eisenstein, H. L. St¨ ormer, D. C. Tsui, A. C. Gossard, and J. H. English, “Observation of an even-denominator quantum number in the fractional quantum Hall effect,” Phys. Rev. Lett.59, 1776–1779 (1987)

  44. [52]

    Tunable interacting composite fermion phases in a half-filled bilayer-graphene Landau level,

    A A Zibrov, C R Kometter, H Zhou, E M Spanton, T Taniguchi, K Watanabe, , M P Zaletel, and A F Young, “Tunable interacting composite fermion phases in a half-filled bilayer-graphene Landau level,” Nature 549, 360–364 (2017)

  45. [53]

    Even- denominator fractional quantum Hall states in bilayer graphene,

    J. I. A. Li, C. Tan, S. Chen, Y. Zeng, T. Taniguchi, K. Watanabe, J. Hone, and C. R. Dean, “Even- denominator fractional quantum Hall states in bilayer graphene,” Science358, 648–652 (2017)

  46. [54]

    The physics of pair-density waves: cuprate superconductors and beyond,

    Daniel F Agterberg, JC S´ eamus Davis, Stephen D Ed- kins, Eduardo Fradkin, Dale J Van Harlingen, Steven A Kivelson, Patrick A Lee, Leo Radzihovsky, John M Tran- quada, and Yuxuan Wang, “The physics of pair-density waves: cuprate superconductors and beyond,” Annual Review of C...

  47. [55]

    Angle-resolved transport non-reciprocity and spontaneous symmetry breaking in twisted trilayer graphene,

    Naiyuan James Zhang, Jiang-Xiazi Lin, Dmitry V. Chichinadze, Yibang Wang, Kenji Watanabe, Takashi Taniguchi, Liang Fu, and J. I. A. Li, “Angle-resolved transport non-reciprocity and spontaneous symmetry breaking in twisted trilayer graphene,” Nature Materi- als23, 356–362 (2024)

  48. [56]

    Coulomb-driven momentum space con- densation in rhombohedral hexalayer graphene,

    Erin Morissette, Peiyu Qin, K Watanabe, T Taniguchi, and JIA Li, “Coulomb-driven momentum space con- densation in rhombohedral hexalayer graphene,” arXiv preprint arXiv:2503.09954 (2025)

  49. [57]

    Anisotropic resistivity tensor from disk geometry magnetoconductance,

    Oskar Vafek, “Anisotropic resistivity tensor from disk geometry magnetoconductance,” Phys. Rev. Appl.20, 064008 (2023)

  50. [58]

    Spontaneous breaking of rotational symmetry in copper oxide super- conductors,

    J Wu, AT Bollinger, X He, and I Boˇ zovi´ c, “Spontaneous breaking of rotational symmetry in copper oxide super- conductors,” Nature547, 432–435 (2017)

  51. [59]

    Angular interplay of ne- maticity, superconductivity, and strange metallicity in a moir´ e flat band,

    Naiyuan J Zhang, Pavel A Nosov, Ophelia Evelyn Som- mer, Yibang Wang, Kenji Watanabe, Takashi Taniguchi, Eslam Khalaf, and JIA Li, “Angular interplay of ne- maticity, superconductivity, and strange metallicity in a moir´ e flat band,” arXiv preprint arXiv:2503.15767 (2025). 10...

Pith tools

Reviewed August 6, 2026 · model on record in the stance chip above.