Digital holographic imaging for free surfaces of superfluid helium

Anthony J. Kent; Chris Goodwin; Ilaria Dimina; Leonardo Solidoro; Marion Cromb; Patrik \v{S}van\v{c}ara; Pietro Smaniotto; Radivoje Prizia; Silke Weinfurtner; Silvia Schiattarella

REVIEW 3 major objections 5 minor 55 references

Digital holographic imaging for free surfaces of superfluid helium

T0 review · 3 major / 5 minor · reviewed 2026-08-15 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read Digital holography captures the full-field surface shape of superfluid helium for the first time.

desk verdict Wet-cryostat DH demonstration is a genuine advance; the dry-cryostat dispersion fit partly validates itself, so treat that section as suggestive rather than confirmatory. read the letter →

arxiv 2509.10235 v2 pith:EEFSKJ5O submitted 2025-09-12 physics.optics

Vitor S. Barroso , Patrik Švančara , Chris Goodwin , Sreelekshmi C. Ajithkumar , Ilaria Dimina , Silvia Schiattarella , Pietro Smaniotto , Leonardo Solidoro

show 4 more authors

Marion Cromb Radivoje Prizia Anthony J. Kent Silke Weinfurtner

This is my paper · ORCID

classification physics.optics

keywords digitalholographysuperfluidheliumfree-surfacewavesgravity-capillarycryogenicopticsnormal-modeanalysissurfacetopographythinfilms

verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

Superfluid helium's free surface is notoriously hard to image: its refractive index is barely different from vacuum, cryogenic enclosures restrict optical access, and cooler vibrations shake the optics. This paper reports that off-axis digital holography can overcome those obstacles, reconstructing full-field surface height maps of superfluid 4He at nanometre-to-micrometre amplitudes in both a helium bath cryostat and a cryogen-free refrigerator. From the reconstructed height fields, the authors isolate noise-excited normal modes and show that their frequencies and wavenumbers follow the gravity-capillary dispersion relation. In the cryogen-free system, the dispersion fit also yields the thickness of a sub-millimetre superfluid film, a quantitative benchmark for the method. If the claims hold, digital holography becomes a minimally invasive, broadly deployable readout for superfluid surface dynamics, from thin films to quantum turbulence.

What carries the argument

The load-bearing object is the off-axis digital hologram: an interference pattern between a reference beam and a probe beam that has passed through or reflected from the superfluid, recorded by a high-speed camera. A spatial Fourier filter isolates the +1 diffraction order, and phase differences between frames are converted to surface height using the refractive-index contrast $\Delta n\simeq0.027$, with the factor-of-two difference between reflective and transmissive geometries. Identification of the observed waves is carried by the classical normal-mode ansatz, Bessel functions in a cylinder with free-slip walls, and by the gravity-capillary dispersion relation, which turns resolved mode frequencies and wavenumbers into a quantitative test. Machine-learning decomposition, through principal component analysis or truncated singular value decomposition, separates noise-driven modes from the background and locates the cell symmetry centre, while in the dry system a fitted global magnification corrects for the meniscus acting as a plano-concave lens.

What would settle it

Place a calibration grid in the sample cell and record holograms with and without the superfluid film; if the required wavenumber rescaling is not a single radius-independent constant but varies across the field of view, the global-magnification model and the inferred film thickness are falsified. Independently, comparing the fitted film thickness with a direct interferometric thickness measurement would settle the dispersion-based benchmark.

Watch

Extended reading notes

Core claim

The central claim is that off-axis digital holography works as a quantitative full-field readout for the free surface of superfluid 4He, despite helium's low refractive index contrast and the mechanical noise of cryogenic systems. The probe beam's phase shift after traversing or reflecting from the sample is converted to surface height through $\phi/(2\pi)=\Delta n\,h/\lambda$ in transmission, with a factor of two larger shift in reflection, and comparing each hologram with a reference frame removes static aberrations. In a 54-mm cylindrical bath-cryostat cell, six low-frequency modes are matched to Bessel normal modes $J_{|m|}(k_{mn}r)e^{im\phi}$, and up to sixteen counter- and co-rotating one-fold pairs are resolved; their frequencies and wavenumbers agree with $\omega_{mn}^2=(g+\sigma k_{mn}^2/\rho)k_{mn}\tanh(h_0 k_{mn})$. In a cryogen-free refrigerator, a one-fold $(m,n)=(1,2)$ mode locates the cell centre, and $m=\pm2$ modes up to 90 Hz follow the same relation when a single global magnification of $1.174\pm0.004$ and a film thickness $h_0=(578\pm21)\,\mu$m are fitted. The paper presents this as a proof of principle that digital holography can be integrated into traditional and cryogen-free platforms.

Load-bearing premise

The quantitative dispersion and thickness results rest on two modelling assumptions: the helium meniscus distorts the image by a single constant magnification, and the surface slips freely at the cell wall; if either is wrong, the extracted wavenumbers and the fitted film thickness are biased.

Editorial extensions

If this is right

Digital holography gives quantitative, full-field surface topography of superfluid helium, not just local slope measurements, over centimetre-scale fields of view.
In a cylindrical cell, ambient mechanical noise alone excites enough normal modes to reconstruct the gravity-capillary dispersion relation without external wave driving.
For thick superfluid films, the dispersion-relation fit returns the absolute film thickness, turning the readout into a self-calibrating thickness measurement.
The method works in cryogen-free refrigerators as well as helium-bath cryostats, so it can be added to existing low-temperature platforms without major optical redesign.
The global phase drift also tracks helium evaporation in real time, giving a continuous measure of mass loss alongside wave imaging.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

A natural next test is to push the same readout to nanometre-thin superfluid films, where third-sound waves and substrate interactions dominate; the reported nanometre sensitivity makes this plausible, but the paper does not demonstrate it.
If the single-magnification lensing model holds, the same holographic data could be inverted locally to map film-thickness variations across the field of view, effectively turning the meniscus distortion into a diagnostic.
Reducing mechanical noise should bring the technique close to the predicted roughly 7-nm dimples of quantised vortices, since the phase sensitivity already resolves sub-micrometre waves; this is an extrapolation, not a result of the paper.
The measured shallow-water speed of $(75\pm2)$ mm/s in the film suggests the method could serve analogue-gravity experiments seeking non-dispersive surface waves, though the paper only notes the platform's potential.

Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Desk Editor's Note

read the letter

Colleague,

The headline: the wet-cryostat half of this paper is the real advance; the dry-cryostat dispersion "benchmark" is partially self-validating, so don't cite it as independent confirmation.

What's actually new: this is the first adaptation of off-axis digital holography to superfluid helium surfaces, done in two cryogenic environments. That's a useful capability for quantum fluids and analogue gravity. The paper does a couple of things well. The mode decomposition in the bath cryostat is careful: they identify spatial Bessel profiles, fit the symmetry origin, and recover a dispersion relation that matches Eq. (2) without any fitted physics. That is a strong internal check. The evaporation-rate monitoring is a nice incidental result.

The soft spots are concentrated in the cryogen-free section. The fit to Eq. (2) uses two free parameters—film thickness h0 and a global magnification prefactor—and both are fitted to the same dispersion curve. The magnification is supposed to correct for meniscus lensing, but if that lensing is radius-dependent, a single constant cannot capture it, and the fitted h0 (578±21 µm) and shallow-water speed (75±2 mm/s) inherit any bias. The agreement in Fig. 4e is therefore suggestive but not a closed loop. The supplementary fits for other azimuthal modes are consistent, which helps, but they use the same fitting protocol. Also, the analysis selects only modes that fit well; that's normal, but it should be acknowledged as selection. And 'data available upon request' is weak for a paper whose central claim depends on quantitative phase reconstruction.

The stress-test note you passed me is right about the dry-system circularity, but the wet-cryostat result stands on its own. The paper is honest about its limitations; no red flags in the citation pattern; the machine-learning language is mostly PCA/SVD, which is fine but could be described more plainly.

Who is this for? Experimentalists in superfluid hydrodynamics and analogue gravity who need a full-field surface probe. The method paper deserves a serious referee: the claims are concrete, the wet benchmark is solid, and the dry-system weaknesses are addressable in revision. I'd accept it for review with a request for a more transparent accounting of the dry-system fitting, plus raw data or processed data release for at least one dataset.

Referee Report

3 major / 5 minor

Summary. The paper reports the first implementation, to the authors' knowledge, of off-axis digital holography (DH) as a full-field optical readout for the free surface of superfluid 4He, demonstrated in two cryogenic platforms: a helium bath cryostat and a cryogen-free refrigerator. The method reconstructs time-resolved surface height maps from holographic phase shifts, resolves individual normal modes via spectral filtering and principal-component analysis, and recovers the gravity-capillary dispersion relation, Eq. (2). In the wet cryostat, mode frequencies and Bessel-function spatial profiles are compared with predictions based on a Neumann boundary condition and no fitted physics; in the dry system, the dispersion is recovered by fitting Eq. (2) with two free parameters, a film thickness h0 and a global wavenumber magnification factor, yielding h0 = (578 ± 21) µm.

Significance. If the claims hold, this is a valuable new capability for studying superfluid surface dynamics, with clear relevance to wave turbulence, analogue gravity, and quantum optomechanics. The wet-cryostat results provide strong internal support: the reconstructed spatial profiles of individual modes match Bessel functions, the azimuthal decomposition is consistent with m = ±1 modes, and the dispersion points follow Eq. (2) without fitted physics in the wet system. The dry-system demonstration is a useful proof of concept but is weaker as a quantitative benchmark because the magnification and thickness are fitted to the same dispersion relation. The paper does not provide public data or code, limiting independent verification of the quantitative claims.

major comments (3)

[§II C, Fig. 4e, Eq. (2)] The cryogen-free dispersion benchmark is self-calibrating and therefore does not independently validate the wavenumber reconstruction. The two fitted parameters—the film thickness h0 and a global prefactor that rescales all measured wavenumbers—both determine the theoretical curve, so agreement with Eq. (2) can absorb systematic errors in the radial-coordinate mapping. If the meniscus acts as a radius-dependent lens rather than a constant magnification, modes with different radial index n would be rescaled differently, biasing the inferred h0 = (578 ± 21) µm and the shallow-water speed c = (75 ± 2) mm/s quoted in the Discussion. The authors should provide an independent calibration of the magnification (e.g., imaging a known test pattern through the same film or measuring h0 by an independent technique) or explicitly reframe the dry-system result as an internal consistency check rather than an independent validation of the reconstructed wavenumbers.
[§II B, Fig. 2a and Fig. 2d, Eqs. (1)–(2)] The identification of modes A–F is partly circular. In Fig. 2a the spectral peaks are labeled by matching their frequencies to values predicted from Eq. (2) with the assumed Neumann boundary condition; these labels are then used to organize the dispersion points in Fig. 2d. Although the subsequent Bessel-profile fitting provides independent wavenumber information, the radial fits operate within a small central field of view (≈6.3 mm radius) where different radial indices n are visually similar, as the text itself states. The authors should quantify how sensitive the fitted wavenumbers are to the assumed (m, n) assignment, for example by allowing the mode indices to be selected purely from the spatial data or by reporting fit residuals for alternative assignments.
[§II B, Eq. (2) and boundary condition at R = 27 mm] The wet-cryostat mode labels and the resulting dispersion relation assume a Neumann (free-slip) boundary condition at the cell wall. If the actual contact line is pinned (Dirichlet) or partially pinned, all predicted mode frequencies shift and the assignment of observed peaks to (m, n) changes. The agreement shown in Fig. 2a is presented as preliminary justification, but a match between observed peaks and one boundary-condition choice is not an independent test of that choice. Please report the sensitivity of the recovered dispersion to the boundary condition, for example by comparing the predicted frequencies for Dirichlet conditions and stating whether the same modes A–F would remain the nearest assignments to the observed peaks.

minor comments (5)

[Abstract and §II B] The phrase 'machine-learning-based analysis' is used for PCA and truncated SVD, which are classical linear dimensionality-reduction techniques; consider describing them more precisely as 'statistical signal-decomposition methods' to avoid overstating the machine-learning content.
[§II B, Fig. 2a inset] The vertical lines marking predicted Bessel-mode frequencies in Fig. 2a are not accompanied by a stated scaling or normalization; please specify how their heights are chosen so that the visual alignment is interpretable.
[Fig. S3 caption] The histograms in Fig. S3 are normalized by image size in pixels, but the text reports an accuracy 'better than 2 mm'; please provide the pixel-to-millimetre conversion in the caption.
[§II C] The sentence 'The latter parameter was introduced to adjust the divergence created by the superfluid sample acting as a plano-concave lens' is ambiguous; please specify that the divergence is in the probe beam and explain how a single constant magnification factor accounts for a spatially varying lens effect.
[Discussion] The value c = (456 ± 22) mm/s for the wet system is quoted without explaining whether it comes from a linear fit to the lowest-frequency data points or from the relation c = sqrt(gh0) using h0 = 20 mm; please add a sentence clarifying the derivation.

Circularity Check

2 steps flagged · score 6.0 of 10

Dispersion benchmark is partly self-fulfilling: wet-cryostat mode labels come from Eq. (2) before the 'reconstructed' curve is plotted, and the dry-cryostat agreement is a two-parameter fit including a global wavenumber rescaling.

self definitional [Section II B, Fig. 2a inset and Fig. 2d; Eqs. (1)-(2)]
"The positions of these peaks closely match the frequencies (2) of specific normal modes (1), displayed as vertical lines. This agreement provides preliminary justification for using the Neumann boundary condition in our modelling."

The peaks A-F are assigned (m,n) labels by matching their measured frequencies to omega_mn from Eq. (2). The wavenumbers k_mn used in Fig. 2d are then taken from the same boundary-value problem (J'_|m|(k_mn R)=0) for those assigned labels. Plotting these (k_mn, omega_obs) points against Eq. (2) therefore re-displays the frequency match that was already used for labelling; it is not an independent reconstruction. The paper itself notes that the radial index n cannot be distinguished within the accessible field of view, so the spatial Bessel shapes cannot independently fix n.
fitted input called prediction [Section II C, Fig. 4e; SI Sec. SIII]
"Fit to Eq. (2) yields magnification of 1.174±0.004 and h0 = (578±21)µm (red line, with the red-shaded area marking the 1σconfidence interval)."

The 'benchmark' is a two-parameter fit to the same dispersion relation it claims to verify: h0 is fitted and a global prefactor rescales every measured wavenumber to correct for the assumed meniscus lensing. Because a monotonic dispersion curve can accommodate a global k-rescaling, the good fit does not independently confirm the wavenumber calibration or the constant-magnification lensing model; any systematic error in the radial coordinate mapping is absorbed into the fitted prefactor, biasing h0 and the quoted shallow-water speed c=(75±2) mm/s.

full rationale

The paper's holographic phase retrieval is independent of the dispersion relation, and the identified m-fold symmetry and Bessel spatial profiles provide some independent evidence. However, the quantitative dispersion-relation validation is circular in two distinct places. In the wet cryostat, modes are labelled by matching peak frequencies to Eq. (2); the wavenumbers for Fig. 2d follow from the boundary-condition eigenvalues for those same labels, so the plotted points are selected to lie on the theoretical curve, and the paper concedes the radial index n is not distinguishable within the restricted field of view. In the cryogen-free system, the dispersion 'benchmark' is an explicit two-parameter fit of h0 and a global magnification that rescales all measured wavenumbers; this can absorb calibration errors in the radial coordinate and does not independently confirm the lensing model. No load-bearing self-citation or uniqueness argument is involved; ref. [20] supplies the DH method but not the superfluid result. The basic demonstration of nanometre-scale holographic imaging of the superfluid surface remains intact, so the overall circularity is partial rather than total.

Assumptions & free parameters 4 free parameters · 6 assumptions · 0 invented entities

The quantitative claims rest on standard optical and fluid-dynamic assumptions, with no invented entities. The main fitted content is in the cryogen-free dispersion analysis, where h0 and a magnification prefactor are adjusted to Eq. (2); the wet analysis uses measured geometry and known material constants but assumes the Neumann boundary condition for mode wavenumbers.

free parameters (4)

h0 (cryogen-free film thickness) = 578 +/- 21 um (m=+/-2 fit); 602 +/- 13 um (combined |m|=1..5)
Free parameter in the fit of Eq. (2) to the measured dispersion of |m|=±2 modes; used to determine the film thickness benchmark.
Magnification prefactor (cryogen-free) = 1.174 +/- 0.004
Free parameter that rescales wavenumbers to account for meniscus lensing; fitted in the same dispersion fit as h0.
Symmetry origin coordinates (x0,y0) per mode = Not tabulated; wet accuracy better than 2 mm, dry total fit residual 1.6e-3
Fitted per mode by least-squares regression to Bessel modes; needed for the polar transformation and azimuthal mode separation.
Apparent per-mode wavenumbers from dry radial Bessel fits = Not tabulated; used to build dispersion points in Fig. 4e
The radial profiles in Fig. 4d are fitted to Bessel functions J_2(k_{2,n} r); these apparent wavenumbers are later globally rescaled by the magnification parameter.

assumptions (6)

domain assumption Dispersion relation Eq. (2): omega^2 = (g + sigma/rho k^2) k tanh(h0 k)
Assumed as the benchmark for superfluid surface waves, from Whitham [30]. If the relation or the material constants sigma/rho are wrong, the mode assignments and fitted h0 shift.
domain assumption Free-surface modes satisfy the Helmholtz equation in a circular domain with a Neumann (free-slip) boundary condition, J'_|m|(k_mn R)=0
Used to label normal modes and to set wavenumbers in both cryostats; the paper justifies it by agreement with the data but does not derive it independently.
domain assumption Surface waves are small-amplitude, undamped, and non-interacting over the roughly 20 s acquisition
Justified by the low viscosity of superfluid helium at 1.72 K, giving a viscous decay time 1/(nu k^2) ~ 113 s for k=1 mm^-1; this allows linear superposition of normal modes.
domain assumption Phase-height mapping Eq. (4a,b): phase shift proportional to Delta n h / lambda, with factor 1 for transmission and factor 2 for reflection
Converts reconstructed optical phase into surface height; assumes only surface height changes the optical path and that Delta n = n - n0 is accurate.
domain assumption In the dry system the superfluid film is uniform and coats only the bottom optical port, with the top coating removed by heating to 1.999 K
Required for the single-pass Mach-Zehnder geometry and for interpreting the fitted h0 as a single film thickness.
standard math Angular-spectrum convolution propagation H(k,z) is valid, and in the wet system numerical propagation is not required
Used in Eqs. (6)-(7) for numerical wavefront propagation; the paper supports the wet-system simplification with a comparison in Supplementary Fig. S4.

how reviews work

0 comments

Cite this review

Pith. "Pith review of Digital holographic imaging for free surfaces of superfluid helium." pith.science (2026). https://pith.science/paper/EEFSKJ5O

@misc{pith2026250910235,
  author       = {Pith},
  title        = {Pith review of: Digital holographic imaging for free surfaces of superfluid helium},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/EEFSKJ5O}},
  note         = {Machine review of arXiv:2509.10235}
}

abstract

Visualising the free surface of superfluid helium offers a rare opportunity to explore wave dynamics in the limit of vanishing viscosity. Such measurements are nonetheless challenging due to helium's low refractive index contrast, restricted optical access to the cryogenic setups required to maintain helium in its superfluid phase, and mechanical vibrations from the various cooling stages. Overcoming these limitations will enable quantitative studies of surface-wave dynamics with applications in fluid mechanics, quantum simulation, and quantum optomechanics. Here we report an implementation of off-axis digital holography for full-field imaging of the free surface of superfluid $^\text{4}$He. We perform non-contact measurements of nanometre- to micrometre-scale interface fluctuations in two cryogenic systems: a traditional helium bath cryostat and a cryogen-free refrigerator. We employ machine-learning-based analysis to isolate noise-driven normal modes and their spatial structure in both systems. This enables reconstruction of the dispersion relation for gravity-capillary waves in macroscopic samples and, for thick films, determination of the film thickness from the measured dispersion, providing a quantitative benchmark for our approach. These proof-of-concept experiments show that digital holography is a powerful and versatile tool for high-resolution, minimally invasive studies of superfluid surfaces, with strong potential for integration into diverse experimental platforms.

Figures

Figures reproduced from arXiv: 2509.10235 by the authors.

**Figure 2.** FIG. 2 [PITH_FULL_IMAGE:figures/full_fig_p005_2.png] view at source ↗

**Figure 3.** FIG. 3 [PITH_FULL_IMAGE:figures/full_fig_p006_3.png] view at source ↗

Figures from the paper (1 more)

**Figure 4.** Figure 4: e. We specifically extract the frequencies and wavenumbers of all two-fold modes (m = ±2, coloured points) and fit the dispersion relation (Eq. (2), red line) as follows. We fix the surface tension-density ratio to σ/ρ = 2.43 × 10−6 m3/s 2 , corresponding to temperatur…

Review history (2 revisions) →

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

55 extracted references · 53 canonical work pages

[1]

G. V. Kolmakov, P. V. E. McClintock, and S. V. Nazarenko, Capillary turbulence on the surfaces of quan- tum fluids, inProgress in Low Temperature Physics, Vol. 16, edited by W. P. Halperin (Elsevier, 2009) p. 203–255

work page 2009
[2]

G. V. Kolmakov, P. V. E. McClintock, and S. V. Nazarenko, Wave turbulence in quantum fluids, Proc. Natl. Acad. Sci. U.S.A.111, 4727–4734 (2014)

work page 2014
[3]

L. V. Abdurakhimov, M. Y. Brazhnikov, I. A. Remizov, and A. A. Levchenko, Observation of wave energy accu- mulation in the turbulent spectrum of capillary waves on the He-II surface under harmonic pumping, JETP Lett. 91, 271–276 (2010)

work page 2010
[4]

Mezhov-Deglin, A

L. Mezhov-Deglin, A. Pel’menev, and A. Levchenko, Kelvin-Helmholtz instability forced by the intensive Fara- day waves on the free surface of superfluid He-II, Mater. Lett.238, 226–228 (2019)

work page 2019
[5]

P. L. Marston and W. M. Fairbank, Evidence of a large superfluid vortex in 4He, Phys. Rev. Lett.39, 1208–1211 (1977). 11

work page 1977
[6]

Tsepelin, H

V. Tsepelin, H. Alles, A. Babkin, R. Jochemsen, A. Parshin, and I. Todoshchenko, Morphology and growth kinetics of 3he crystals below 1 mk, J. Low Temp. Phys.129, 489–530 (2002)

work page 2002
[7]

I. A. Todoshchenko, H. Alles, H. J. Junes, A. Y. Parshin, and V. Tsepelin, Growth Dynamics and Faceting of 3He Crystals, J. Low Temp. Phys.148, 635–643 (2007)

work page 2007
[8]

J. R. T. Seddon, M. S. Thurlow, M. J. Lees, and P. G. J. Lucas, Quantised vortex line visualisation in superfluid helium using low-temperature optics, Phys. B Condens. Matter329-333, 220–221 (2003)

work page 2003

Show all 55 references

[9]

Vittoratos, M

E. Vittoratos, M. W. Cole, and P. P. M. Meincke, Free surface of a rotating HeII film, Can. J. Phys.51, 2283–2286 (1973)

1973
[10]

J. R. T. Seddon, M. S. Thurlow, and P. G. J. Lucas, Quantised vortex visualisation, J. Low Temp. Phys.138, 499–504 (2005)

2005
[11]

Moisy, M

F. Moisy, M. Rabaud, and K. Salsac, A synthetic Schlieren method for the measurement of the topography of a liquid interface, Exp. Fluids46, 1021–1036 (2009)

2009
[12]

E. F. Burton, Refractive indexes of helium I and II, Na- ture140, 1015 (1937)

1937
[13]

Wildeman, Real-time quantitative Schlieren imaging by fast Fourier demodulation of a checkered backdrop, Exp

S. Wildeman, Real-time quantitative Schlieren imaging by fast Fourier demodulation of a checkered backdrop, Exp. Fluids59, 97 (2018)

2018
[14]

ˇSvanˇ cara, P

P. ˇSvanˇ cara, P. Smaniotto, L. Solidoro, J. F. MacDonald, S. Patrick, R. Gregory, C. F. Barenghi, and S. Weinfurt- ner, Rotating curved spacetime signatures from a giant quantum vortex, Nature628, 66–70 (2024)

2024
[15]

Smaniotto, L

P. Smaniotto, L. Solidoro, P. ˇSvanˇ cara, S. Patrick, M. Richartz, C. F. Barenghi, R. Gregory, and S. We- infurtner, Black-hole spectroscopy from a giant quantum vortex (2025), arXiv:2502.11209 [gr-qc]

2025 arXiv
[16]

Yaroslavsky,Digital Holography and Digital Image Processing(Springer New York, 2013)

L. Yaroslavsky,Digital Holography and Digital Image Processing(Springer New York, 2013)

2013
[17]

Picart and J

P. Picart and J. Li,Digital Holography, ISTE (Wiley- ISTE Newark, 2013)

2013
[18]

Schnars, C

U. Schnars, C. Falldorf, J. Watson, and W. J¨ uptner,Dig- ital Holography and Wavefront Sensing(Springer Berlin, Heidelberg, 2014)

2014
[19]

Bhaduri, C

B. Bhaduri, C. Edwards, H. Pham, R. Zhou, T. H. Nguyen, L. L. Goddard, and G. Popescu, Diffraction phase microscopy: principles and applications in materi- als and life sciences, Adv. Opt. Photon.6, 57–119 (2014)

2014
[20]

V. S. Barroso, A. Geelmuyden, S. C. Ajithkumar, A. J. Kent, and S. Weinfurtner, Multiplexed digital holography for fluid surface profilometry, Appl. Opt.62, 7175–7184 (2023)

2023
[21]

Huang and L

Z. Huang and L. Cao, Quantitative phase imaging based on holography: trends and new perspectives, Light Sci. Appl.13, 145 (2024)

2024
[22]

mm/s, but the linear approximation breaks down be- low the lowest-frequency mode detected (cf. Fig. 2d). In superfluid films, however, the propagation speed is sig- nificantly reduced. In the example shown in Fig. 4, we measurec= (75±2) mm/s, which effectively extends the shal...
[23]

Y. Park, C. Depeursinge, and G. Popescu, Quantitative phase imaging in biomedicine, Nat. Photon.12, 578–589 (2018)

2018
[24]

X. Yu, J. Hong, C. Liu, and M. K. Kim, Review of dig- ital holographic microscopy for three-dimensional profil- ing and tracking, Opt. Eng.53, 112306 (2014)

2014
[25]

J. Wu, G. Zheng, and L. M. Lee, Optical imaging tech- niques in microfluidics and their applications, Lab Chip 12, 3566–3575 (2012)

2012
[26]

Kumar and G

R. Kumar and G. Dwivedi, Emerging scientific and in- dustrial applications of digital holography: an overview, Eng. Res. Express5, 032005 (2023)

2023
[27]

Smits, A

J. Smits, A. P. Mosk, and P. van der Straten, Imaging trapped quantum gases by off-axis holography, Opt. Lett. 45, 981–984 (2020)

2020
[28]

Pobell,Matter and Methods at Low Temperatures, 3rd ed

F. Pobell,Matter and Methods at Low Temperatures, 3rd ed. (Springer Berlin, Heidelberg, 2007)

2007
[29]

Colomb, J

T. Colomb, J. K¨ uhn, F. Charri` ere, C. Depeursinge, P. Marquet, and N. Aspert, Total aberrations compen- sation in digital holographic microscopy with a refer- ence conjugated hologram, Opt. Express14, 4300–4306 (2006)

2006
[30]

R. J. Donnelly and C. F. Barenghi, The observed prop- erties of liquid helium at the saturated vapor pressure, J. Phys. Chem. Ref. Data27, 1217–1274 (1998)

1998
[31]

Whitham, Linear dispersive waves, inLinear and Non- linear Waves(John Wiley & Sons, 1999) Chap

G. Whitham, Linear dispersive waves, inLinear and Non- linear Waves(John Wiley & Sons, 1999) Chap. 11, pp. 361–402

1999
[32]

H. Li, G. C. Linderman, A. Szlam, K. P. Stanton, Y. Kluger, and M. Tygert, Algorithm 971: An implemen- tation of a randomized algorithm for principal component analysis, ACM Trans. Math. Softw.43, 28 (2017)

2017
[33]

C. D. Manning, P. Raghavan, and H. Sch¨ utze, Matrix decompositions and latent semantic indexing, inIntro- duction to Information Retrieval(Cambridge University Press, 2008) p. 369–384

2008
[34]

S. C. Ajithkumar, V. S. Barroso, P. ˇSvanˇ cara, A. J. Kent, and S. Weinfurtner, Optical lever for broad- band detection of fluid interface fluctuations (2025), arXiv:2506.05275 [physics.optics]

2025
[35]

R. Lake, S. Simbierowicz, P. Krantz, F. Hassani, and J. M. Fink,The Bluefors Dilution Refrigerator as an Integrated Quantum Measurement System, Application Note (Bluefors Oy, Helsinki, Finland, 2021)

2021
[36]

Smetana, T

J. Smetana, T. Yan, V. Boyer, and D. Martynov, A high- finesse suspended interferometric sensor for macroscopic quantum mechanics with femtometre sensitivity, Sensors 24, 2375 (2024)

2024
[37]

J. W. Goodman,Speckle Phenomena in Optics: Theory and Applications(SPIE Press Bellingham, 2020)

2020
[38]

Montresor and P

S. Montresor and P. Picart, Quantitative appraisal for noise reduction in digital holographic phase imaging, Opt. Express24, 14322–14343 (2016)

2016
[39]

Sch¨ utzhold and W

R. Sch¨ utzhold and W. G. Unruh, Gravity wave analogues of black holes, Phys. Rev. D66, 044019 (2002)

2002
[40]

C. R. D. Bunney, V. S. Barroso, S. Biermann, A. Geel- muyden, C. Gooding, G. Ithier, X. Rojas, J. Louko, and S. Weinfurtner, Third sound detectors in accelerated mo- tion, New J. Phys.26, 065001 (2024)

2024
[41]

M. T. Reeves, W. W. Wasserman, R. A. Harrison, I. Marinkovic, N. Luu, A. Sawadsky, Y. L. Sfendla, G. I. Harris, W. P. Bowen, and C. G. Baker, Nonlinear wave dynamics on a chip (2025), arXiv:2504.13001 [physics.flu- dyn]

2025 arXiv
[42]

Y. L. Sfendla, C. G. Baker, G. I. Harris, L. Tian, R. A. Harrison, and W. P. Bowen, Extreme quantum nonlinear- ity in superfluid thin-film surface waves, NPJ Quantum Inf.7, 62 (2021)

2021
[43]

S. Chen, C. Li, C. Ma, T.-C. Poon, and Y. Zhu, Phase sensitivity of off-axis digital holography, Opt. Lett.43, 4993–4996 (2018)

2018
[44]

Bianco, P

V. Bianco, P. Memmolo, M. Leo, S. Montresor, C. Dis- tante, M. Paturzo, P. Picart, B. Javidi, and P. Ferraro, Strategies for reducing speckle noise in digital hologra- phy, Light Sci. Appl.7, 48 (2018). 12

2018
[45]

M. R. Sultanova, I. A. Remizov, L. P. Mezhov-Deglin, and A. A. Levchenko, Generation of quantum vortices by waves on the surface of superfluid helium, JETP Lett. 118, 585–590 (2023)

2023
[46]

Peretti, J

C. Peretti, J. Vessaire, ´Emeric Durozoy, and M. Gibert, Direct visualization of the quantum vortex lattice struc- ture, oscillations, and destabilization in rotating 4He, Sci. Adv.9, eadh2899 (2023)

2023
[47]

M. T. Jarema, C. R. D. Bunney, V. S. Barroso, M. Tajik, C. Goodwin, and S. Weinfurtner, Information in quan- tum field theory simulators: Thin-film superfluid helium (2025), arXiv:2508.07247 [quant-ph]

2025 arXiv
[48]

Harris, On the use of windows for harmonic analy- sis with the discrete Fourier transform, Proc

F. Harris, On the use of windows for harmonic analy- sis with the discrete Fourier transform, Proc. IEEE66, 51–83 (1978)

1978
[49]

Cuche, P

E. Cuche, P. Marquet, and C. Depeursinge, Spatial filter- ing for zero-order and twin-image elimination in digital off-axis holography, Appl. Opt.39, 4070–4075 (2000)

2000
[50]

Verrier and M

N. Verrier and M. Atlan, Off-axis digital hologram recon- struction: some practical considerations, Appl. Opt.50, H136–H146 (2011)

2011
[51]

Karray, P

M. Karray, P. Slangen, and P. Picart, Comparison be- tween digital Fresnel holography and digital image-plane holography: the role of the imaging aperture, Exp. Mech. 52, 1275–1286 (2012)

2012
[52]

J. Li, P. Tankam, Z. Peng, and P. Picart, Digital holo- graphic reconstruction of large objects using a convolu- tion approach and adjustable magnification, Opt. Lett. 34, 572–574 (2009)

2009
[53]

J. Li, Z. Peng, and Y. Fu, Diffraction transfer function and its calculation of classic diffraction formula, Opt. Commun.280, 243–248 (2007)

2007
[54]

Welch, The use of fast Fourier transform for the esti- mation of power spectra: A method based on time av- eraging over short, modified periodograms, IEEE Trans

P. Welch, The use of fast Fourier transform for the esti- mation of power spectra: A method based on time av- eraging over short, modified periodograms, IEEE Trans. Audio Electroacoust.15, 70–73 (1967)

1967
[55]

Pedregosa, G

F. Pedregosa, G. Varoquaux, A. Gramfort, V. Michel, B. Thirion, O. Grisel, M. Blondel, P. Prettenhofer, R. Weiss, V. Dubourg, J. Vanderplas, A. Passos, D. Cour- napeau, M. Brucher, M. Perrot, and E. Duchesnay, Scikit-learn: Machine learning in Python, J. Mach. Learn. Res.12, 2...

2011

Pith tools

Reviewed August 15, 2026 · model on record in the stance chip above.

[1] [1]

G. V. Kolmakov, P. V. E. McClintock, and S. V. Nazarenko, Capillary turbulence on the surfaces of quan- tum fluids, inProgress in Low Temperature Physics, Vol. 16, edited by W. P. Halperin (Elsevier, 2009) p. 203–255

work page 2009

[2] [2]

G. V. Kolmakov, P. V. E. McClintock, and S. V. Nazarenko, Wave turbulence in quantum fluids, Proc. Natl. Acad. Sci. U.S.A.111, 4727–4734 (2014)

work page 2014

[3] [3]

L. V. Abdurakhimov, M. Y. Brazhnikov, I. A. Remizov, and A. A. Levchenko, Observation of wave energy accu- mulation in the turbulent spectrum of capillary waves on the He-II surface under harmonic pumping, JETP Lett. 91, 271–276 (2010)

work page 2010

[4] [4]

Mezhov-Deglin, A

L. Mezhov-Deglin, A. Pel’menev, and A. Levchenko, Kelvin-Helmholtz instability forced by the intensive Fara- day waves on the free surface of superfluid He-II, Mater. Lett.238, 226–228 (2019)

work page 2019

[5] [5]

P. L. Marston and W. M. Fairbank, Evidence of a large superfluid vortex in 4He, Phys. Rev. Lett.39, 1208–1211 (1977). 11

work page 1977

[6] [6]

Tsepelin, H

V. Tsepelin, H. Alles, A. Babkin, R. Jochemsen, A. Parshin, and I. Todoshchenko, Morphology and growth kinetics of 3he crystals below 1 mk, J. Low Temp. Phys.129, 489–530 (2002)

work page 2002

[7] [7]

I. A. Todoshchenko, H. Alles, H. J. Junes, A. Y. Parshin, and V. Tsepelin, Growth Dynamics and Faceting of 3He Crystals, J. Low Temp. Phys.148, 635–643 (2007)

work page 2007

[8] [8]

J. R. T. Seddon, M. S. Thurlow, M. J. Lees, and P. G. J. Lucas, Quantised vortex line visualisation in superfluid helium using low-temperature optics, Phys. B Condens. Matter329-333, 220–221 (2003)

work page 2003