pith. sign in

arxiv: 2603.24693 · v2 · pith:IRWYV22Knew · submitted 2026-03-25 · ✦ hep-ph · astro-ph.CO· hep-ex· hep-th

Cogenesis of visible and dark matter in type-I Dirac seesaw

classification ✦ hep-ph astro-ph.COhep-exhep-th
keywords diracasymmetrycogenesisdarkseesawtype-iwhileasymmetric
0
0 comments X
read the original abstract

We propose a novel cogenesis framework based on the type-I Dirac seesaw mechanism. The minimal type-I Dirac seesaw with three heavy vector-like fermions $(N)$, one singlet scalar $(\eta)$, and the right-handed counterparts $(\nu_R)$ of the Standard Model (SM) neutrinos is extended to include a Dirac fermion dark matter (DM) $(\chi)$ and its heavier scalar companion ($\phi$). The out-of-equilibrium decays of the vector-like fermion generate asymmetries simultaneously in the visible sector, through decay channels involving $(\nu_R,\eta)$ or lepton, Higgs doublets in the SM, and in the dark sector via decaying into $(\chi,\phi)$. The resulting lepton asymmetry is partially converted into the observed baryon asymmetry by electroweak sphaleron processes, while the dark-sector asymmetry survives to constitute the present-day asymmetric DM relic. The generation of asymmetries in multiple sectors and their mutual washouts provide rich dynamics while also keeping the model testable at different observations involving DM, neutrinos, cosmic microwave background (CMB), as well as gravitational waves (GW). We find that successful cogenesis can be realized for DM masses in the range $100~\mathrm{MeV} \lesssim m_\chi \lesssim 39~\mathrm{TeV}$. The lower bound arises from the requirement that the symmetric component of DM annihilates efficiently before the big bang nucleosynthesis (BBN) epoch, while the upper bound is set by unitarity constraints on the asymmetric DM.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Imprint of matter-antimatter asymmetry on collapsing domain walls

    hep-ph 2026-04 unverdicted novelty 8.0

    Radiative corrections from an asymmetric Dirac fermion generate a bias that collapses domain walls, producing gravitational waves that encode the asymmetry level and temperature.