Pith. sign in

REVIEW 3 cited by

DreamFrame: Enhancing Video Understanding via Automatically Generated QA and Style-Consistent Keyframes

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2403.01422 v5 pith:IYFUPKGK submitted 2024-03-03 cs.CV

classification cs.CV
keywords dreamframelvlmsstyledatasetdatasetskeyframeslvlmpairs
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Recent large vision-language models (LVLMs) for video understanding are primarily fine-tuned with various videos scraped from online platforms. Existing datasets, such as ActivityNet, require considerable human labor for structuring and annotation before effectively utilized for tuning LVLMs. While current LVLMs are primarily trained on existing datasets in broad, general-purpose settings, adapting them to specific downstream scenarios remains challenging, as collecting and annotating task-specific videos is highly labor-intensive and time-consuming. To address this issue, we propose a three-stage framework named DreamFrame for automatically generating style-consistent keyframes and corresponding question-answer (QA) pairs to support LVLM instruction tuning. DreamFrame generates datasets in a movie-like manner. First, we utilize an LLM to generate structured movie plots including movie prior information (like overview and style), frame descriptions and plot-related QA pairs, with a story expansion strategy to mitigate context length limitations.Then, to ensure visual consistency across generated frames, we design a Style Immobilization Process which maintains consistent style through an embedding learning strategy. Finally, frame descriptions and style embeddings are integrated to produce coherent keyframes. Using DreamFrame, we construct a dataset comprising approximately 1k stylized keyframe-like videos and 100k diverse QA pairs. Extensive fine-tuned experiments on various LVLM architectures demonstrate the effectiveness of the proposed dataset. Furthermore, based on the proposed dataset, we fine-tune a new LVLM named DreamFrame-7B, which significantly surpasses the previous similar-sized LVLMs across different benchmarks.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 3 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. UniForm: A Unified Multi-Task Diffusion Transformer for Audio-Video Generation

    cs.MM 2025-02 conditional novelty 6.0 of 10

    UniForm trains one diffusion transformer on a shared audio-video latent space to handle video-to-audio, audio-to-video, and text-to-audio-video generation with competitive results.

  2. Antigen-specific Antibody Multi-modal Foundation Model for Functional Antibody Design

    q-bio.BM 2026-07 reject novelty 5.0 of 10

    AAMFM combines ESM3, an antigen-geometry adapter, and Cal-DPO preference optimization rewarded by AlphaFold3-style scores to design antibody CDRs and structures, reporting higher predicted binding scores than prior methods.

  3. Multimodal Large Language Model-Enabled Video Translation: A Role-Oriented Survey

    cs.CV 2026-04 unverdicted novelty 5.0 of 10

    The paper offers the first focused review of MLLM-based video translation organized by a three-role taxonomy of Semantic Reasoner, Expressive Performer, and Visual Synthesizer, plus open challenges.

Pith tools