Pith. sign in

REVIEW

Low Energy Magneto-optics of Tb$_{2}$Ti$_{2}$O$_{7}$ in [111] Magnetic Field

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2009.12354 v1 pith:KVTVYALD submitted 2020-09-25 cond-mat.str-el

classification cond-mat.str-el
keywords fieldcrystalenergymagneticdependentenvironmentexcitationshigh
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
abstract

The pyrochlore magnet Tb$_{2}$Ti$_{2}$O$_{7}$ shows a lack of magnetic order to low temperatures and is considered to be a quantum spin liquid candidate. We perform time-domain THz spectroscopy on high quality Tb$_{2}$Ti$_{2}$O$_{7}$ crystal and study the low energy excitations as a function of [111] magnetic field with high energy resolution. The low energy crystal field excitations change their energies anomalously under magnetic field. Despite several sharp field dependent changes, we show that the material's spectrum can be described not by a phase transitions, but by field dependent hybridization between the low energy crystal field levels. We highlight the strong coupling between spin and lattice degrees of freedom in Tb$_{2}$Ti$_{2}$O$_{7}$ as evidenced by the magnetic field tunable crystal field environment. Calculations based on single ion physics with field induced symmetry reduction of the crystal field environment can reproduce our data.

Discussion (0). Continue with ORCID to comment.

Pith tools