Pith. sign in

REVIEW 2 cited by

FaceLift: Learning Generalizable Single Image 3D Face Reconstruction from Synthetic Heads

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2412.17812 v2 pith:OB6FY4XO submitted 2024-12-23 cs.CV cs.GR

classification cs.CVcs.GR
keywords reconstructionsyntheticviewfacefaceliftimageinputsingle
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

We present FaceLift, a novel feed-forward approach for generalizable high-quality 360-degree 3D head reconstruction from a single image. Our pipeline first employs a multi-view latent diffusion model to generate consistent side and back views from a single facial input, which then feeds into a transformer-based reconstructor that produces a comprehensive 3D Gaussian splats representation. Previous methods for monocular 3D face reconstruction often lack full view coverage or view consistency due to insufficient multi-view supervision. We address this by creating a high-quality synthetic head dataset that enables consistent supervision across viewpoints. To bridge the domain gap between synthetic training data and real-world images, we propose a simple yet effective technique that ensures the view generation process maintains fidelity to the input by learning to reconstruct the input image alongside the view generation. Despite being trained exclusively on synthetic data, our method demonstrates remarkable generalization to real-world images. Through extensive qualitative and quantitative evaluations, we show that FaceLift outperforms state-of-the-art 3D face reconstruction methods on identity preservation, detail recovery, and rendering quality.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. VoluMe -- Authentic 3D Video Calls from Live Gaussian Splat Prediction

    cs.CV 2025-07 conditional novelty 6.0 of 10

    VoluMe predicts real-time 3D Gaussian head reconstructions from a single webcam feed, preserving the input view while allowing realistic novel viewpoints for 3D video calls.

  2. Decomposing Densification in Gaussian Splatting for Faster 3D Scene Reconstruction

    cs.CV 2025-07 conditional novelty 5.0 of 10

    A split-then-clone densification schedule with energy-guided multi-resolution training roughly halves 3D Gaussian Splatting training time while keeping reconstruction quality.

Pith tools