The reviewed record of science sign in
Pith

arxiv: 2405.20730 · v2 · pith:OHJLGFNW · submitted 2024-05-31 · astro-ph.IM

GRAVITY for MATISSE -- Improving the MATISSE performance with the GRAVITY fringe tracker

Reviewed by Pith T0 review T1 audit T2 compute T3 formal T4 kernel pith:OHJLGFNWrecord.jsonopen to challenge →

classification astro-ph.IM
keywords matissefringegravitytrackerdatagra4matinstrumentcapability
0
0 comments X
read the original abstract

Context: MATISSE, the mid-infrared spectro-imaging instrument of VLTI, was designed to deliver its advertised performance when paired with an external second generation fringe tracker. Science observation started in 2019, demonstrating imaging capabilities and faint science target observations. Now, The GRAVITY fringe tracker stabilizes the MATISSE fringes which allows using all spectroscopic modes and improves sensitivity and data accuracy. Aims: We present how the MATISSE and GRAVITY instruments were adapted to make the GRAVITY fringe tracker work with MATISSE, under the umbrella of the aptly-named GRA4MAT project, led by ESO in collaboration with the two instrument consortia. Methods: We detail the software modifications needed to implement an acquisition and observing sequence specific to GRA4MAT, including simultaneous fringe tracking and chopping and a narrow off-axis capability inspired by the galactic center and exoplanet capability of GRAVITY. We explain the modified data collection and reduction processes. We show how we leveraged the recent fringe tracker upgrade to implement features specific to its use with MATISSE, e.g. fringe jumps mitigation with an improved group delay control and simultaneous fringe tracking and chopping with a new state machine. Results: We successfully demonstrate significant improvements to the MATISSE instrument. Observations can now be performed at higher spectral resolutions of up to $R\sim3300$ and across the full LM bands at once. Long detector integration times, made possible with stabilized fringes, have improved the LM-bands sensitivity by a factor of 10. Low flux biases in coherently-reduced N-band data have been eliminated. The L-band transfer function is now higher and more stable. We finally illustrate the scientific potential of GRA4MAT with a preview of the first exoplanet observation made by MATISSE on $\beta$ Pictoris b.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.