Pith. sign in

REVIEW 1 cited by

Step-wise Distribution Alignment Guided Style Prompt Tuning for Source-free Cross-domain Few-shot Learning

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2411.10070 v2 pith:ZXAKDSIK submitted 2024-11-15 cs.CV

classification cs.CV
keywords distributionpromptalignmentstepsptstylecdfsldatafew-shot
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Existing cross-domain few-shot learning (CDFSL) methods, which develop source-domain training strategies to enhance model transferability, face challenges with large-scale pre-trained models (LMs) due to inaccessible source data and training strategies. Moreover, fine-tuning LMs for CDFSL demands substantial computational resources, limiting practicality. This paper addresses the source-free CDFSL (SF-CDFSL) problem, tackling few-shot learning (FSL) in the target domain using only pre-trained models and a few target samples without source data or strategies. To overcome the challenge of inaccessible source data, this paper introduces Step-wise Distribution Alignment Guided Style Prompt Tuning (StepSPT), which implicitly narrows domain gaps through prediction distribution optimization. StepSPT proposes a style prompt to align target samples with the desired distribution and adopts a dual-phase optimization process. In the external process, a step-wise distribution alignment strategy factorizes prediction distribution optimization into a multi-step alignment problem to tune the style prompt. In the internal process, the classifier is updated using standard cross-entropy loss. Evaluations on five datasets demonstrate that StepSPT outperforms existing prompt tuning-based methods and SOTAs. Ablation studies further verify its effectiveness. Code will be made publicly available at https://github.com/xuhuali-mxj/StepSPT.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Multi-Scale Convolution with Optimal Transport Attention Effect on Multivariate Time Series

    cs.LG 2026-07 conditional novelty 5.0 of 10

    MSC-OT fuses multi-scale convolution and Sinkhorn OT regularization into inverted attention, producing small but consistent MSE/MAE gains over iTransformer and several recent MTS baselines on five public datasets.

Pith tools