pith. the verified trust layer for science. sign in

arxiv: 1407.5193 · v1 · pith:FUFM4XTGnew · submitted 2014-07-19 · 🧮 math.CO

Some spectral properties of uniform hypergraphs

classification 🧮 math.CO
keywords somelaplaciangivehypergraphsspectralciteformulashypergraph
0
0 comments X p. Extension
Add this Pith Number to your LaTeX paper What is a Pith Number?
\usepackage{pith}
\pithnumber{FUFM4XTG}

Prints a linked pith:FUFM4XTG badge after your title and writes the identifier into PDF metadata. Compiles on arXiv with no extra files. Learn more

read the original abstract

For a $k$-uniform hypergraph $H$, we obtain some trace formulas for the Laplacian tensor of $H$, which imply that $\sum_{i=1}^nd_i^s$ ($s=1,\ldots,k$) is determined by the Laplacian spectrum of $H$, where $d_1,\ldots,d_n$ is the degree sequence of $H$. Using trace formulas for the Laplacian tensor, we obtain expressions for some coefficients of the Laplacian polynomial of a regular hypergraph. We give some spectral characterizations of odd-bipartite hypergraphs, and give a partial answer to a question posed by Shao et al \cite{ShaoShanWu}. We also give some spectral properties of power hypergraphs, and show that a conjecture posed by Hu et al \cite{HuQiShao} holds under certain conditons.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.