pith. sign in

arxiv: 1902.08341 · v2 · pith:M4ZSMXR2new · submitted 2019-02-22 · 📊 stat.ML · cs.LG

FAVAE: Sequence Disentanglement using Information Bottleneck Principle

classification 📊 stat.ML cs.LG
keywords factorsdynamicdatadisentangledisentangledfavaesequentialrepresentation
0
0 comments X
read the original abstract

We propose the factorized action variational autoencoder (FAVAE), a state-of-the-art generative model for learning disentangled and interpretable representations from sequential data via the information bottleneck without supervision. The purpose of disentangled representation learning is to obtain interpretable and transferable representations from data. We focused on the disentangled representation of sequential data since there is a wide range of potential applications if disentanglement representation is extended to sequential data such as video, speech, and stock market. Sequential data are characterized by dynamic and static factors: dynamic factors are time dependent, and static factors are independent of time. Previous models disentangle static and dynamic factors by explicitly modeling the priors of latent variables to distinguish between these factors. However, these models cannot disentangle representations between dynamic factors, such as disentangling "picking up" and "throwing" in robotic tasks. FAVAE can disentangle multiple dynamic factors. Since it does not require modeling priors, it can disentangle "between" dynamic factors. We conducted experiments to show that FAVAE can extract disentangled dynamic factors.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.