pith. sign in

arxiv: math/0504164 · v7 · submitted 2005-04-08 · 🧮 math.CO

Log-concavity and LC-positivity

classification 🧮 math.CO
keywords lc-positivesequencedoublelog-concavitytriangledefinedimpliesthen
0
0 comments X
read the original abstract

A triangle $\{a(n,k)\}_{0\le k\le n}$ of nonnegative numbers is LC-positive if for each $r$, the sequence of polynomials $\sum_{k=r}^{n}a(n,k)q^k$ is $q$-log-concave. It is double LC-positive if both triangles $\{a(n,k)\}$ and $\{a(n,n-k)\}$ are LC-positive. We show that if $\{a(n,k)\}$ is LC-positive then the log-concavity of the sequence $\{x_k\}$ implies that of the sequence $\{z_n\}$ defined by $z_n=\sum_{k=0}^{n}a(n,k)x_k$, and if $\{a(n,k)\}$ is double LC-positive then the log-concavity of sequences $\{x_k\}$ and $\{y_k\}$ implies that of the sequence $\{z_n\}$ defined by $z_n=\sum_{k=0}^{n}a(n,k)x_ky_{n-k}$. Examples of double LC-positive triangles include the constant triangle and the Pascal triangle. We also give a generalization of a result of Liggett that is used to prove a conjecture of Pemantle on characteristics of negative dependence.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.