Pith. sign in

REVIEW 6 cited by

Detecting GAN generated Fake Images using Co-occurrence Matrices

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 1903.06836 v2 pith:6YGYMOT4 submitted 2019-03-15 cs.CV eess.IV

classification cs.CVeess.IV
keywords imagesapproachco-occurrencefakematricesachievesdatasetsdeep
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

The advent of Generative Adversarial Networks (GANs) has brought about completely novel ways of transforming and manipulating pixels in digital images. GAN based techniques such as Image-to-Image translations, DeepFakes, and other automated methods have become increasingly popular in creating fake images. In this paper, we propose a novel approach to detect GAN generated fake images using a combination of co-occurrence matrices and deep learning. We extract co-occurrence matrices on three color channels in the pixel domain and train a model using a deep convolutional neural network (CNN) framework. Experimental results on two diverse and challenging GAN datasets comprising more than 56,000 images based on unpaired image-to-image translations (cycleGAN [1]) and facial attributes/expressions (StarGAN [2]) show that our approach is promising and achieves more than 99% classification accuracy in both datasets. Further, our approach also generalizes well and achieves good results when trained on one dataset and tested on the other.

Discussion (0). Sign in to comment.

Forward citations

Cited by 6 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Test-Time Curriculum for Open-Set AIGC Detection

    cs.CV 2026-08 conditional novelty 6.0 of 10

    A curriculum-based test-time adaptation method, using balanced confident pseudo-labels and multi-scale refinement, improves AIGC detector accuracy on unseen generators by 11 to 29 points over its starting detector.

  2. LaP-Forensics: Latent-Pixel Consistency Guided Multimodal Reasoning for Deepfake Detection

    cs.CV 2026-07 conditional novelty 6.0 of 10

    A dual-stream deepfake forensic model that adds DDIM reconstruction residuals to RGB features improves artifact localization and cross-generator detection in evaluations, with honest caveats about text faithfulness.

  3. PhantomSeal: Proactive Deepfakes Defense with Identity/Context Protection and Forensic Tracing

    cs.CR 2026-07 conditional novelty 6.0 of 10

    A single perturbation can steer face-swap outputs toward a chosen 'cloak' identity, giving both identity/context protection and forensic tracing.

  4. Do Transformations Reveal the Truth? Generative Residual Learning for Generalized AI-Generated Image Detection

    cs.CV 2026-07 conditional novelty 6.0 of 10

    Modeling the differential response of real versus AI-generated images under secondary generative transformations yields state-of-the-art cross-generator detection on 19 unseen models.

  5. RAVID: Retrieval-Augmented Visual Detection: A Knowledge-Driven Approach for AI-Generated Image Identification

    cs.CV 2025-08 conditional novelty 6.0 of 10

    RAVID detects AI-generated images by retrieving similar images from a database and feeding them to a vision-language model, reporting 93.85% average accuracy on UniversalFakeDetect.

  6. Perceptual Classifiers: Detecting Generative Images using Perceptual Features

    cs.CV 2025-07 conditional novelty 5.0 of 10

    A two-layer classifier trained on CONTRIQUE image-quality features achieves state-of-the-art accuracy on GenImage and DRCT-2M fake-image detection benchmarks.

Pith tools