Pith. sign in

REVIEW 3 major objections 5 minor 66 references

Observation of the Stimulated Quantum Cherenkov Effect

T0 review · 3 major / 5 minor · reviewed 2026-08-14 · deepseek-v4-flash

Pith's one-line read By phase-matching a relativistic electron wavefunction to an evanescent light wave over hundreds of microns, this paper shows that each electron simultaneously absorbs and emits hundreds of photons, forming a quantized energy comb—the…

desk verdict Strong experiment with a clear quantized energy comb; the phase-matched Cherenkov interpretation is plausible and the main claims hold up, though the precise coupling extraction leans on fitted parameters and an unmeasured beam-surface distance. read the letter →

arxiv 1909.00757 v2 pith:7V7RL5C2 submitted 2019-09-02 physics.optics physics.acc-phquant-ph

classification physics.opticsphysics.acc-phquant-ph
keywords Cherenkoveffectquantumelectrodynamicsfree-electronradiationultrafasttransmissionelectronmicroscopyevanescentwavephase-matchingenergycombwavefunction
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper reports the first experimental demonstration of the stimulated quantum Cherenkov effect. In an ultrafast transmission electron microscope, a relativistic electron is made to graze the surface of a glass prism while an evanescent light wave travels along the same direction; when the Cherenkov phase-matching condition $v_e = \omega/k_z$ is maintained over hundreds of microns, the electron's wavefunction simultaneously absorbs and emits hundreds of photons, ending up as a coherent ladder of energy states separated by $\hbar\omega \approx 1.7$ eV. The measured spectrum is a quantized plateau spanning hundreds of electron-volts, and the authors interpret the match with quantum theory as direct evidence that stimulated free-electron radiation can depend on the electron wavefunction rather than only on its point-charge trajectory. The result matters because it turns a century-old classical effect into a platform for quantum control of free electrons, with implications for accelerators, light sources, and electron microscopy.

What carries the argument

The load-bearing object is the dimensionless coupling constant $g=(q_e/\hbar\omega)\int E_z \exp(i\omega z/v_e)\,dz$ evaluated along the electron trajectory. The exponential phase factor controls the interaction: away from resonance, the contribution oscillates and cancels; at the Cherenkov condition $v_e=\omega/k_z$, the factor is stationary, so the coupling accumulates over the whole effective interaction length $L_{\rm eff}$, which the grazing-angle prism geometry extends to roughly 350–500 μm instead of the usual few hundred nanometres. The evanescent tail of a totally internally reflected 730 nm laser beam in a BK7 prism ($n=1.512$) provides the field $E_z \propto e^{K_x x + i k_z z}$, and the large $|g|$ makes the final electron state a coherent superposition of energy sidebands spaced by $\hbar\omega$—the quantized plateau.

What would settle it

A decisive check would be to deliberately tilt the electron beam relative to the prism surface, for example by 1 mrad, or to shorten the interaction length in controlled steps, and observe whether the single-photon-spaced peaks in the energy spectrum disappear exactly as the coupling model predicts; a direct measurement of the electron-surface distance during the interaction would also settle the assumed evanescent-field strength.

Watch

Extended reading notes

Core claim

The central claim is that the Cherenkov effect, when the electron is treated as a wavefunction and the interaction is kept phase-matched over a long distance, is intrinsically quantum: a single electron can absorb and emit hundreds of photons coherently. The experimental fingerprint is a comb of discrete peaks in the electron energy-loss spectrum, with adjacent peaks separated by the photon energy $\hbar\omega \approx 1.7$ eV and the whole plateau extending over hundreds of electron-volts, up to about 850 eV in the strongest record. According to the paper, the classical point-charge description produces only the smooth average of this comb and cannot reproduce the individual quantized peaks, so the observation identifies the wavefunction of the electron as the object that is phase-matched and modulated. The authors present this as the first evidence that stimulated radiation from a free electron depends on the electron's quantum wavefunction.

Load-bearing premise

The central claim rests on the assumption that the electron beam truly grazes the prism surface at a nearly constant distance of a few hundred nanometres, remaining parallel over hundreds of microns, so that the evanescent field amplitude and the phase-matching are maintained; an unaccounted tilt, drift, or helical motion caused by the magnetic field would weaken the coupling and blur the comb.

Editorial extensions

If this is right

  • The same electron light-matter interaction can in principle be used to imprint a controllable comb of hundreds of energy sidebands on a free-electron beam, turning the electron itself into a multi-frequency quantum probe.
  • Because the effect depends on the electron wavefunction rather than on a point-charge trajectory, it provides a test bed for wavefunction engineering in free-electron radiation, with implications for dielectric laser accelerators and other classical designs.
  • The phase-matching scheme should generalize to other stimulated free-electron processes, such as the Smith–Purcell effect and undulator emission, where quantum sidebands are predicted to appear under analogous long-interaction conditions.
  • The measured spectra, including the energy gain/loss asymmetry, constrain quantum-electrodynamic corrections such as electron dispersion over long interaction lengths, and provide a benchmark for future nonperturbative QED models of Cherenkov radiation.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • A direct extension of the paper's logic is that the same quantized comb should appear in other evanescent platforms—plasmonic waveguides, photonic crystals, or dielectric microstructures—whenever phase-matching is preserved over a comparable length.
  • A next-step experiment could measure the coherence of the comb by sending the modulated electron through a second phase-matched interaction and looking for interference fringes in the final energy spectrum; the paper does not report such a measurement.
  • The unexplained gain/loss asymmetry in the spectrum could be a signature of electron-dispersion corrections that grow with interaction length; scanning the acceleration voltage across the 2 keV sidelobe structure would test this.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 5 minor

Summary. The manuscript reports an ultrafast transmission electron microscope experiment in which 207.2 keV electrons graze the surface of a BK7 prism while a 730 nm laser pulse undergoes total internal reflection, producing an evanescent field. The authors claim to satisfy the Cherenkov phase-matching condition over hundreds of microns, reaching coupling constants |g| ≈ 15–25 and causing each electron to coherently absorb and emit many photons. The central evidence is a measured electron energy-loss spectrum showing discrete peaks separated by ℏω ≈ 1.7 eV over a range of hundreds of eV, which is compared with a quantum model and contrasted with a classical point-charge description. The paper interprets this as the first experimental evidence of the stimulated quantum Cherenkov effect and of the dependence of stimulated free-electron radiation on the electron's quantum wavefunction.

Significance. If the interpretation is correct, this would be a significant advance: it would demonstrate a phase-matched, macroscopically long stimulated interaction in which the quantum wave nature of a free electron is manifest, extending the previously demonstrated PINEM comb into a new Cherenkov-phase-matched regime with very large coupling. The discrete peak spacing is a parameter-free quantum signature, and the resolved comb over a large energy range is a striking result. However, the quantitative claims (|g|, the number of exchanged photons, and the effective interaction length) depend on fitted parameters and on an unmeasured electron-surface distance, and there are internal numerical inconsistencies that must be resolved before those quantitative conclusions are secure.

major comments (3)
  1. [Results, Fig. 4 and Methods] The reported coupling strengths and energy spreads are mutually inconsistent. The text states that the pink spectrum corresponds to |g| > 25 and a maximum energy gain/loss > 85 eV, while the Fig. 4 caption states that the maximal energy transfer increases to >850 eV, and the following paragraph says the comb spreads over more than a thousand electron-volts. The Methods section further states that electrons gain or lose up to 300 quanta. Since ΔE_max = 2|g|ℏω with ℏω ≈ 1.7 eV, |g| > 25 implies ΔE_max ≈ 85 eV, not 850 eV, and 300 quanta would require |g| ≈ 150. The manuscript must reconcile these numbers; as written, the headline claim of 'hundreds of photons' is not consistent with the reported |g| values.
  2. [Eq. (2), Methods: Grazing-angle interaction] The inferred coupling constant is exponentially sensitive to the electron-surface distance: Eq. (2) gives g(x0) ∝ exp(−K_x x0). The evanescent decay length is roughly 115 nm for the stated parameters, while the Methods section reports a helix radius of 0.86 μm and estimates the helix-induced distance change as ≤100 nm. The initial distance, the helix phase, beam tilt, and drift during the interaction are not directly measured. The theory used to fit the time-delay scans (Fig. 4c) includes the beam divergence, the effective interaction length, and the laser pulse shape as fitted inputs, so |g| and the distance are degenerate in the fit. This does not invalidate the discrete comb signature, but it means the quantitative claims |g| ≈ 15–25 and 'hundreds of exchanged photons' are not independently supported.
  3. [Discussion and Fig. 4c] The Discussion acknowledges that dispersion corrections from the large energy exchange 'can no longer be neglected,' yet the theoretical comparison in Fig. 4c appears to use the standard linearized model of Eq. (2) with a fixed electron velocity. For energy changes of order 100 eV at 207.2 keV, the fractional velocity change is about 10^-4, and over a 500 μm interaction this produces a phase slip of order 1 rad at λ = 730 nm. This is not negligible for the claimed maintenance of phase matching over hundreds of microns. The manuscript should either include these dispersion corrections in the fitted model or quantify how much they affect the predicted spectrum and the extracted |g|.
minor comments (5)
  1. [Abstract and Methods] There are several typographical errors: in the abstract 'jet plane s' should be 'jet planes', and in the Methods the electron energy '2 7.2KeV' should presumably read '207.2 keV'.
  2. [Fig. 3b caption] The caption states 'Δ ≈ 1 rad = . 57°,' which appears erroneous; a divergence angle of 1 rad would be enormous. It should likely read 1 μrad = 0.057° or be made consistent with the 1 mrad convergence angle stated in the Methods.
  3. [Methods: Grazing-angle interaction] The claim that this is 'the first realization of such grazing-angle conditions in any transmission electron microscope' is a strong priority claim and should be supported with a reference or softened to 'to the best of our knowledge.'
  4. [Fig. 1d and Fig. 4] The experimental spectra are presented without uncertainty estimates or error bars, and the fitted |g| values are quoted without confidence intervals. Since the central quantitative claims rest on these fits, at least representative uncertainty propagation should be reported.
  5. [Discussion, asymmetry in Fig. 1d] The asymmetry between gain and loss sides is attributed to bulk plasmon emission and core losses, but these mechanisms are not quantified or subtracted. A quantitative estimate of their expected contribution would strengthen the interpretation.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: the quantized comb is an external observable, not an input to the derivation.

full rationale

The paper's central empirical claim is the observation of a discrete, equally spaced electron energy comb with spacing set by the laser photon energy ℏω. That spacing is fixed by the experimental laser wavelength and the quantum model, not by the fitted coupling constant g or by the fitted beam divergence, pulse shape, or effective interaction length. The coupling constant g from Eqs. (1)–(2) sets the overall number and envelope of sidebands, but the existence and spacing of the peaks is a structurally different prediction: the classical point-charge model yields a smooth spectrum, while the quantum model yields Bessel sidebands at multiples of ℏω. Fitting g to the spectral width does not manufacture the discrete peaks, which are resolved directly in the measured EELS data. Similarly, the fitted beam divergence and laser pulse shape affect only the envelope and overall strength of the theoretical spectra, not the comb's quantization. The authors' self-citations to their earlier quantum-Cherenkov theory papers (e.g., Refs. 10, 30, 13, 33) are not load-bearing in a circular sense: the new experimental data serve as an external benchmark, and the cited theory does not define the measured spectrum by construction. The reviewer's concern about the unmeasured electron–prism distance and possible helical motion is a significant experimental-uncertainty/correctness issue, but it is not a circularity: it challenges the inferred value of g and the interaction length, not the logical derivation of the comb from the model. No equation in the paper defines the predicted result in terms of the observed peak positions or counts, and no uniqueness claim is imported from the authors' prior work to force the interpretation. Therefore the paper is self-contained against an external measurement and exhibits no significant circularity.

Assumptions & free parameters 3 free parameters · 4 assumptions · 0 invented entities

The central claim rests on standard electrodynamics and the established PINEM quantum formalism, with no new free parameters beyond those used to fit the experimental envelope. The beam divergence and pulse shape are fitted to the data, but the comb spacing itself is a parameter-free prediction.

free parameters (3)
  • Beam divergence angle Δ = ≈ 1 mrad (0.057°)
    Estimated by fitting the interaction strength vs. interface length data (Fig. 3b). Controls the average electron-surface distance and therefore the evanescent field coupling.
  • Effective interaction length L_eff = not stated numerically
    Adjusted to match the time-delay scan and spectra (Fig. 4c, Supplementary Note 4b). Governs the total accumulated coupling g.
  • Laser pulse temporal shape (including OPA sidelobes) = not stated numerically
    Modeled to fit the time-delay scan (Fig. 4c, Supplementary Note 4b). Affects which electrons see maximum field amplitude.
assumptions (4)
  • domain assumption The electron-light interaction is described by the PINEM quantum theory: a single electron in a classical coherent laser field exchanges integer numbers of photons, producing a Bessel-function comb in energy.
    Invoked in Supplementary Note 1; based on Refs. 39-40. Central to predicting the quantized spectrum.
  • domain assumption The evanescent field near the prism has the form E_z(r) = E_0,z e^{-K_x x + i k_z z} and remains coherent over the interaction length.
    Used in Eqs. 1-2; standard electrodynamics for total internal reflection.
  • domain assumption The electron's velocity and dispersion are approximated as constant over the interaction, with dispersion corrections neglected except for the asymmetry discussion.
    Mentioned in Discussion as a possible cause of asymmetry; used in the main derivation.
  • domain assumption The Cherenkov phase-matching condition cos θ = c/(n v_e) is satisfied by the prism geometry and beam alignment.
    Central to the long coherent interaction; set by the 45° prism base angle and 4.5° incidence angle.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Observation of the Stimulated Quantum Cherenkov Effect." pith.science (2026). https://pith.science/paper/7V7RL5C2

@misc{pith2026190900757,
  author       = {Pith},
  title        = {Pith review of: Observation of the Stimulated Quantum Cherenkov Effect},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/7V7RL5C2}},
  note         = {Machine review of arXiv:1909.00757}
}
read the original abstract

As charged particles surpass the speed of light in an optical medium they produce radiation - analogously to the way jet planes surpass the speed of sound and produce a sonic boom. This radiation emission, known as the Cherenkov effect, is among the most fundamental processes in electrodynamics. As such, it is used in numerous applications of particle detectors, particle accelerators, light sources, and medical imaging. Surprisingly, all Cherenkov-based applications and experiments thus far were fully described by classical electrodynamics even though theoretical work predicts new Cherenkov phenomena coming from quantum electrodynamics. The quantum description could provide new possibilities for the design of highly controllable light sources and more efficient accelerators and detectors. Here, we provide a direct evidence of the quantum nature of the Cherenkov effect and reveal its intrinsic quantum features. By satisfying the Cherenkov condition for relativistic electron wavefunctions and maintaining it over hundreds of microns, each electron simultaneously accelerates and decelerates by absorbing and emitting hundreds of photons in a coherent manner. We observe this strong interaction in an ultrafast transmission electron microscope, achieving for the first time a phase-matching between a relativistic electron wavefunction and a propagating light wave. Consequently, the quantum wavefunction of each electron evolves into a coherent plateau, analogous to a frequency comb in ultrashort laser pulses, containing hundreds of quantized energy peaks. Our findings prove that the delocalized wave nature of electrons can become dominant in stimulated interactions. In addition to prospects for known applications of the Cherenkov effect, our work provides a platform for utilizing quantum electrodynamics for applications in electron microscopy and in free-electron pump-probe spectroscopy.

Figures

Figures reproduced from arXiv: 1909.00757 by the authors.

Figure 1
Figure 1. Quantum vs. classical phase-matching of an electron and light. Our experimental results show the strong quantum interaction of the electron wavefunction. (a) Illustration of the phase-matching effect for both the classical and quantum interpretations. The electron interacts with an evanescent field generated by a laser that is totally internally reflected from an interface. Classical: a point electron (small particl… view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

66 extracted references · 66 canonical work pages

  1. [1]

    Cherenkov, P. A. Visible emission of clean liquids by action of 𝛾 radiation. Dokl. Akad. Nauk SSSR 2, 451-454 (1934)

  2. [2]

    & Jelley, J

    Galbraith, W. & Jelley, J. V. Light pulses from the night sky associated with cosmic rays. Nature 171, 349–350 (1953)

  3. [3]

    Kimura, W. D. et al. Laser acceleration of relativistic electrons using the inverse Cherenkov effect. Phys. Rev. Lett. 74, 546 (1995)

  4. [4]

    Kozák, M. et al. Acceleration of sub-relativistic electrons with an evanescent optical wave at a planar interface. Opt. Express 25, 19195-19204 (2017)

  5. [5]

    Vijayraghavan, K. et al. Broadly Tunable Terahertz Generation in Mid -infrared Quantum Cascade Lasers. Nat. Comm. 4, 2021 (2013)

  6. [6]

    Thorek, D. L. J. et al. Quantitative Imaging of Disease Signatures through Radioactive Decay Signal Conversion. Nat. Med. 19, 1345 (2013)

  7. [7]

    Friedman, A. et al. Spontaneous and stimulated emission from quasifree electrons. Rev. Mod. Phys. 60, 471 (1988)

  8. [8]

    Beam -wave interaction in periodic and quasi -periodic structures

    Schächter, L. Beam -wave interaction in periodic and quasi -periodic structures. (Springer, Berlin Heidelberg, 1997)

Show all 66 references
  1. [9]

    Ginzburg, V. L. Quantum theory of light radiation by electron uniformly moving in medium. J. Exp. Theor. Phys. 10, 589-600 (1940)

  2. [10]

    Kaminer, I. et al. Quantum Cherenkov radiation: spectral cutoffs and the role of spin and orbital angular momentum. Phys. Rev. X 6, 011006 (2016)

  3. [11]

    Gover, A. et al. Superradiant and stimulated -superradiant emission of bunched electron beam s. Rev. Mod. Phys. 91, 035003 (2019)

  4. [12]

    to appear Nature Phys

    Rivera, N., et al., Light emission based on nanophotonic vacuum forces. to appear Nature Phys. (2019)

  5. [13]

    & Gover, A

    Pan, Y., Zhang, B. & Gover, A. Anomalous photon-induced near-field electron microscopy. Phys. Rev. Lett. 122, 183204 (2019)

  6. [14]

    & de Abajo, F

    Polman, A., Kociak, M. & de Abajo, F. J. G. Electron-beam spectroscopy for nanophotonics. Nat. Mater. (2019)

  7. [15]

    Anderson, T. I. et al. Electron -phonon instability in graphene revealed by global and local noise probes. Science 364, 154-157 (2019)

  8. [16]

    M., Pratt, E

    Shaffer, T. M., Pratt, E. C., & Grimm, J. Utilizing the power of Cherenkov light with nanotechnology. Nat. Nano. 12, 106-117 (2017)

  9. [17]

    & Seguinot, J

    Ypsilantis, T. & Seguinot, J. Theory of ring imaging Cherenkov counters. Nucl. Instrum. Meth. A 343, 30–51 (1994)

  10. [18]

    Lin, X. et al. Controlling Cherenkov angles with resonance transition radiation. Nat. Phys. 14, 816- 821 (2018)

  11. [19]

    Ruggiero, A. et al. Cherenkov luminescence imaging of medical isotopes. J. Nucl. Med. 51, 1123- 1130 (2010)

  12. [20]

    Luo, C. et al. Cerenkov Radiation in Photonic Crystals. Science 299, 368 (2003)

  13. [21]

    de Abajo, F. J. G. et al. Cherenkov Effect as a Probe of Photonic Nanostructures. Phys. Rev. Lett. 91, 143902 (2003)

  14. [22]

    Adamo, G. et al. Light well: A tunable free -electron light source on a chip. Phys. Rev. Lett. 103, 113901 (2009)

  15. [23]

    Genevet, P. et al. Controlled steering of Cherenkov surface plasmon wakes with a one-dimensional metamaterial. Nat. Nano. 10, 804-809 (2015)

  16. [24]

    Surface radiation from non-linear optical polarisation

    Zembrod, A., Puell, H., and Gjordmaine, A. Surface radiation from non-linear optical polarisation. Opt. Quant. Electron. 1, 64 (1969)

  17. [25]

    Hu. Y. et al. Cherenkov radiation control via self-accelerating wave-packets. Sci. Rep. 7, 8695 (2017)

  18. [26]

    Edighoffer, J. A. et al. Observation of inverse Cherenkov interaction between free electrons and laser light. Phys. Rev. A. 23, 1848 (1981)

  19. [27]

    Fontana, J. P. & Pantell, R. H. A high-energy, laser accelerator for electrons using the inverse Cherenkov effect. J. Appl. Phys. 54, 4285 (1983)

  20. [28]

    Quantum theory of Cherenkov effect

    Sokolov, A. Quantum theory of Cherenkov effect. Dokl. Akad. Nauk SSSR 28, 415-417 (1940)

  21. [29]

    Ginzburg, V. L. Radiation by uniformly moving sources (Vavilov -Cherenkov effect, transition radiation, and other phenomena). Phys. Usp. 39, 973 (1996)

  22. [30]

    Roques-Carmes, C. et al. Nonperturbative quantum electrodynamics in the Cherenkov effect. Phys. Rev. X 8, 041013 (2018)

  23. [31]

    Kaminer, I. et al. Self-accelerating Dirac particles and prolonging the lifetime of relativistic fermions. Nat. Phys. 11, 261 (2015)

  24. [32]

    Murdia, C. et al. Controlling light emission with electron wave interference. arXiv:1712.04529 [quant-ph] (2017)

  25. [33]

    & Pan, Y

    Gover, A. & Pan, Y. Dimension -dependent stimulated radiative interaction of a single electron quantum wavepacket. Phys. Lett. A 382, 1550-1555 (2018)

  26. [34]

    Remez, R. et al. Observing the quantum wave nature of free electrons through spontaneous emission. Phys. Rev. Lett. 123, 060401 (2019)

  27. [35]

    Zewail, A. H. Four-dimensional electron microscopy. Science 328, 187-193 (2010)

  28. [36]

    Feist, A. et al. Ultrafast transmission electron microscopy using a laser-driven field emitter: Femtosecond resolution with a high coherence electron beam. Ultramicroscopy 176, 63-73 (2017)

  29. [37]

    Our grazing-angle interaction differs from regular electron microscope experiments in which thin samples are used (tens to a few hundred nanometers)

    The effective interaction length is three orders of magnitude larger than that achieved in previous works owing to our proprietary grazing -angle interaction setup. Our grazing-angle interaction differs from regular electron microscope experiments in which thin samples are use...

  30. [38]

    Barwick, B. et al. Photon-induced near-field electron microscopy. Nature 462, 902-906 (2009)

  31. [39]

    de Abajo, F. J. G. et al. Multiphoton absorption and emission by interaction of swift electrons with evanescent light fields. Nano Lett. 10, 1859-1863 (2010)

  32. [40]

    Park, S. T. et al. Photon-induced near-field electron microscopy (PINEM): theoretical and experimental. New J. Phys. 12, 123028 (2010)

  33. [41]

    Feist, A. et al. Quantum coherent optical phase modulation in an ultrafast transmission electron microscope. Nature 521, 200-203 (2015)

  34. [42]

    Piazza, L. et al. Simultaneous observation of the quantization and the interference pattern of a plasmonic near-field. Nat. Comm. 6, 6407 (2015)

  35. [43]

    Kealhofer, C. et al. All -optical control and metrology of electron pulses. Science 352, 429-433 (2016)

  36. [44]

    & Zewail, A.H

    Liu, H., Baskin, J.S. & Zewail, A.H. Infrared PINEM developed by diffraction in 4D UEM. PNAS 113, 2041-2046 (2016)

  37. [45]

    Vanacore, G. M. et al. Ultrafast generation and control of an electron vortex beam via chiral plasmonic near fields. Nat. Mater. 18, 573-579 (2019)

  38. [46]

    Madan, I. et al. Holographic imaging of electromagnetic fields via electron-light quantum interference. Sci. Adv. 5, eaav8358 (2019)

  39. [47]

    Das, P. et al. Stimulated electron energy loss and gain in an electron microscope without a pulsed electron gun. Ultramicroscopy 203, 44-51 (2019)

  40. [48]

    Wang, K. et al. Coherent interaction between free electrons and cavity photons. arXiv:1908.06206 [physics.optics] (2019)

  41. [49]

    2 is no longer periodic and instead of canceling out after every period of the field it is accumulated over the periods

    With the phase-matching condition satisfied, the integrand in Eq. 2 is no longer periodic and instead of canceling out after every period of the field it is accumulated over the periods. Therefore, it seems that 𝑔 would diverge for an infinite interaction length, but in practi...

  42. [50]

    Tilted electron pulses

    Ehberger, D., Ryabov, A., & Baum, P. Tilted electron pulses. Phys. Rev. Lett. 121, 094801 (2018)

  43. [51]

    Vanacore, G. M. et al. Attosecond coherent control of free -electron wave functions using semi - infinite light fields. Nat. Comm. 9, 2694 (2018)

  44. [52]

    The effective interaction length is limited in practice by the length of the medium, the transverse spatial extent of the incident laser pulse (initial spot size) on the interface, and the temporal duration of the laser pulse; see Supplementary Note 4b

  45. [53]

    Quantum theory of near-field electrodynamics

    Keller, O. Quantum theory of near-field electrodynamics. (Springer, Berlin Heidelberg, 2012)

  46. [54]

    These sidelobes explain the features seen in the time scan at time delays before and after the main interaction

    The OPA changes the laser's temporal pulse shape and adds temporal sidelobes on the two sides of the center Gaussian -like pulse. These sidelobes explain the features seen in the time scan at time delays before and after the main interaction

  47. [55]

    Agostini, P. et al. Free-free transitions following six-photon ionization of xenon atoms. Phys. Rev. Lett. 42, 1127 (1979)

  48. [56]

    Corkum, P. B. & Krausz, F. Attosecond science. Nat. Phys. 3, 381-387 (2007)

  49. [57]

    Nature Comm

    Guzzinati, G., et al., Probing the symmetry of the potential of localized surface plasmon resonances with phase-shaped electron beams. Nature Comm. 8, 14999 (2017)

  50. [58]

    & Schächter, L

    Mizrahi, A. & Schächter, L. Optical Bragg accelerators. Phys. Rev. E 70, 016505 (2004)

  51. [59]

    Peralta, E. A. et al. Demonstration of electron acceleration in a laser-driven dielectric microstructure. Nature 503, 91-94 (2013)

  52. [60]

    England, R. J. et al. Dielectric laser accelerators. Rev. Mod. Phys. 86, 1337 (2014)

  53. [61]

    Mizuno, K. et al. Experimental evidence of the inverse Smith -Purcell effect. Nature 328, 45-47 (1987)

  54. [62]

    Kaminer, I. et al. Spectrally and spatially resolved Smith-Purcell radiation in plasmonic crystals with short-range disorder. Phys. Rev. X 7, 011003 (2017)

  55. [63]

    and Kaminer, I., Light generation via quantum interaction of electrons with periodic nanostructures

    Tsesses, S., Bartal, G. and Kaminer, I., Light generation via quantum interaction of electrons with periodic nanostructures. PRA 95, 013832 (2017)

  56. [64]

    Lynch, M. et al. Quantum radiation from electrons in strong fields. CLEO FF3D.7 (2019)

  57. [65]

    Entanglements of electrons and cavity -photons in the strong coupling regime

    Kfir, O. Entanglements of electrons and cavity -photons in the strong coupling regime. To appear in Phys. Rev. Lett. (2019)

  58. [66]

    Di Giulio, V., Kociak, M., & de Abajo, F. J. G. Probing quantum optical excitations with fast electrons. arXiv:1905.06887 [quant-ph] (2019)

Pith tools

Reviewed August 14, 2026 · model on record in the stance chip above.