Pith. sign in

REVIEW

Linear Diophantine equations in Piatetski-Shapiro sequences

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2009.12899 v2 pith:FSX6IREQ submitted 2020-09-27 math.NT math.MG

classification math.NTmath.MG
keywords alphamanymathrminfinitelypiatetski-shapirosequencearithmeticarticle
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
abstract

A Piatetski-Shapiro sequence with exponent $\alpha$ is a sequence of integer parts of $n^\alpha$ $(n = 1,2,\ldots)$ with a non-integral $\alpha > 0$. We let $\mathrm{PS}(\alpha)$ denote the set of those terms. In this article, we study the set of $\alpha$ so that the equation $ax + by = cz$ has infinitely many pairwise distinct solutions $(x,y,z) \in \mathrm{PS}(\alpha)^3$, and give a lower bound for its Hausdorff dimension. As a corollary, we find uncountably many $\alpha > 2$ such that $\mathrm{PS}(\alpha)$ contains infinitely many arithmetic progressions of length $3$.

Discussion (0). Continue with ORCID to comment.

Pith tools