Pith. sign in

REVIEW 2 major objections 2 minor 45 references

Automating Potential-based Reward Shaping with Vision Language Model Guidance

T0 review · 2 major / 2 minor · reviewed 2026-06-26 · grok-4.3

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read VLM preferences over image pairs can train a potential function that shapes rewards, speeds learning, and leaves optimal policies unchanged.

desk verdict VLM-PBRS shows small VLMs can supply usable preferences for learning a PBRS potential function, with reported speedups in Meta-World and Franka Kitchen. read the letter →

arxiv 2606.27180 v1 pith:DHAIKAOS submitted 2026-06-25 cs.LG cs.AIcs.RO

Henrik Müller , Daniel Kudenko This is my paper · ORCID
classification cs.LGcs.AIcs.RO
keywords reinforcementlearningrewardshapingvisionlanguagemodelspotential-basedsampleefficiencysparserewardspolicypreservation
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper shows that a vision language model can supply preference labels on pairs of environment images to train a potential function for use in potential-based reward shaping. This supplies intermediate rewards for sparse-reward reinforcement learning tasks without requiring hand-crafted shaping terms and without altering the set of optimal policies. The method deliberately uses smaller, cheaper VLMs so that repeated queries remain practical during training. Experiments in Meta-World and Franka Kitchen demonstrate faster convergence when the learned potential is added to the original sparse reward.

What carries the argument

The potential function trained directly on VLM preference labels over pairs of state images, which generates the additive shaping reward in the PBRS framework.

What would settle it

An experiment in Meta-World or Franka Kitchen in which adding the learned potential produces no measurable reduction in steps to reach target performance or yields a policy that differs from the one optimal under the original sparse reward.

Watch

Extended reading notes

Core claim

VLM-PBRS queries a lightweight vision language model for preferences over image pairs, trains a model of the potential function on those preferences, and adds the resulting shaping term to the sparse task reward; because the shaping term is potential-based, the original optimal policies remain optimal and the need for expert-designed shaping functions disappears.

Load-bearing premise

That the noisier preference labels produced by smaller VLMs remain informative enough to train a potential function that produces clear sample-efficiency gains.

Editorial extensions

If this is right

  • Optimal policies under the original sparse reward remain optimal after shaping.
  • Sample efficiency improves in the tested robotic manipulation environments.
  • No hand-designed potential function is required.
  • The method reduces vulnerability to reward hacking compared with arbitrary shaping.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • The same preference-to-potential pipeline could be applied to other visual state spaces where sparse rewards currently limit progress.
  • If VLM preference accuracy continues to rise, the sample-efficiency gains may increase without changing the framework.
  • Automating the potential function could make PBRS practical in domains where domain experts are unavailable to design shaping terms.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

2 major / 2 minor

Summary. The paper introduces VLM-PBRS, a framework that queries a lightweight VLM for pairwise preferences over image pairs, trains a potential function Φ from these preferences via a ranking loss, and applies the resulting shaped reward in PBRS to accelerate learning in sparse-reward settings. It claims that the method preserves the original optimal policy set (by PBRS theory), eliminates the need for hand-designed shaping terms, and still yields sample-efficiency gains in Meta-World and Franka Kitchen even when smaller, less accurate VLMs are used; the authors also report a correlation between VLM label accuracy and observed gains.

Significance. If the empirical results hold, the work provides a concrete, low-cost route to automate potential-function design for PBRS using off-the-shelf VLMs, removing a long-standing barrier to applying PBRS in new domains. The explicit linkage between VLM accuracy and sample-efficiency gains is a useful diagnostic contribution.

major comments (2)
  1. [Abstract, §4] Abstract and §4 (empirical validation): the central claim that 'preference labels can still be used to accelerate learning' with smaller VLMs is load-bearing yet rests on an unverified assumption that noisy pairwise preferences remain sufficiently informative after training. The manuscript must report (i) the exact VLM preference accuracy on the target image pairs, (ii) the quantitative sample-efficiency improvement (e.g., steps to 90 % success) versus both unshaped and expert-shaped baselines, and (iii) an ablation showing that performance degrades gracefully rather than introducing new failure modes when accuracy falls below a stated threshold.
  2. [§3] §3 (method): the training procedure for Φ is described only at a high level ('ranking loss on image pairs'). The paper must specify the exact loss, the architecture of the potential network, how image pairs are sampled during training, and whether any regularization is applied to keep Φ bounded—details required to reproduce the claim that the learned Φ yields a valid PBRS signal.
minor comments (2)
  1. [Abstract] The abstract states three contributions but does not explicitly list them; numbering them in the text would improve clarity.
  2. [Figures] Figure captions should state the number of random seeds and whether shaded regions represent standard error or min/max.

Simulated Author's Rebuttal

2 responses · 0 unresolved

We thank the referee for the constructive comments. We address each major point below and will revise the manuscript to incorporate the requested details.

read point-by-point responses

  1. Referee: [Abstract, §4] Abstract and §4 (empirical validation): the central claim that 'preference labels can still be used to accelerate learning' with smaller VLMs is load-bearing yet rests on an unverified assumption that noisy pairwise preferences remain sufficiently informative after training. The manuscript must report (i) the exact VLM preference accuracy on the target image pairs, (ii) the quantitative sample-efficiency improvement (e.g., steps to 90 % success) versus both unshaped and expert-shaped baselines, and (iii) an ablation showing that performance degrades gracefully rather than introducing new failure modes when accuracy falls below a stated threshold.

    Authors: We agree that more granular reporting is needed to fully substantiate the claim. While the manuscript already notes the link between VLM accuracy and sample-efficiency gains, it does not provide the exact accuracy percentages on the target pairs or the requested quantitative metrics. In the revision we will add (i) measured VLM preference accuracy on the image pairs, (ii) steps-to-90%-success for VLM-PBRS versus both the unshaped baseline and an expert-shaped baseline in Meta-World and Franka Kitchen, and (iii) an ablation that varies VLM accuracy (via different models or controlled label noise) to demonstrate that performance degrades gracefully without introducing new failure modes. revision: yes

  2. Referee: [§3] §3 (method): the training procedure for Φ is described only at a high level ('ranking loss on image pairs'). The paper must specify the exact loss, the architecture of the potential network, how image pairs are sampled during training, and whether any regularization is applied to keep Φ bounded—details required to reproduce the claim that the learned Φ yields a valid PBRS signal.

    Authors: We acknowledge that the current description of the potential-function training is high-level and insufficient for full reproducibility. In the revised manuscript we will expand §3 to state the precise ranking loss (including its mathematical form), the neural-network architecture used for Φ, the exact procedure for sampling image pairs from the environments, and any regularization or bounding constraints applied to Φ to ensure it produces a valid PBRS signal. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity; derivation is self-contained

full rationale

The paper applies standard PBRS theory (which guarantees policy preservation for any fixed potential) to a learned Φ trained via ranking loss on VLM pairwise preferences. No equations or steps reduce the output to the input by construction, no self-citations are load-bearing for the core claim, and no fitted parameters are renamed as predictions. Empirical validation in Meta-World and Franka Kitchen stands on external benchmarks rather than definitional equivalence. This is the expected honest non-finding for an empirical RL method.

Assumptions & free parameters 0 free parameters · 0 assumptions · 0 invented entities

Abstract-only review yields no explicit free parameters, axioms, or invented entities; the method rests on the standard PBRS policy-invariance property and the assumption that VLM preferences are usable for potential learning.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Automating Potential-based Reward Shaping with Vision Language Model Guidance." pith.science (2026). https://pith.science/paper/DHAIKAOS

@misc{pith2026260627180,
  author       = {Pith},
  title        = {Pith review of: Automating Potential-based Reward Shaping with Vision Language Model Guidance},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/DHAIKAOS}},
  note         = {Machine review of arXiv:2606.27180}
}
read the original abstract

Sparse rewards are inherently challenging for reinforcement learning agents as they lack intermediate feedback to guide exploration and to correctly attribute the sparse success rewards to relevant parts of the trajectory. Naive reward shaping can induce reward hacking, yielding policies that exploit auxiliary signals instead of solving the intended task. Potential-based reward shaping (PBRS) guarantees preservation of the optimal policy set, but requires the definition of a heuristic potential function over the state space. In this work, we introduce the VLM-guided PBRS framework VLM-PBRS that learns the potential function directly from vision language model (VLM) feedback. We query a lightweight VLM to obtain preferences over image pairs and train a model of the potential function using these preferences. As this approach is based on potential-based reward shaping, it preserves the original optimal policies, and removes the need for expert-designed reward shaping terms. Because large VLMs are prohibitively expensive to invoke repeatedly during policy learning, we employ smaller, more computationally efficient VLMs. Although the resulting preference labels are less accurate, empirical evidence shows that the preference labels can still be used to accelerate learning. We validate our method empirically in the Meta-World and Franka Kitchen environments and highlight the connection between VLM preference label accuracy and sample efficiency improvements. Our contributions are threefold: (1) the first application of VLM preference-based learning to synthesize a potential function for PBRS, (2) a principled, low-cost solution that leverages small VLMs, and (3) extensive empirical demonstration of improved sample efficiency and robustness to reward hacking.

Figures

Figures reproduced from arXiv: 2606.27180 by the authors.

Figure 1
Figure 1. Overview of VLM-PBRS. 2 Related Work We organize the related work around two themes central to this paper: foundational ap￾proaches to reward shaping from domain knowledge, and the emerging literature on learning reward functions from scratch using foundation models. 2.1 Reward Shaping from Domain Knowledge Potential-based reward shaping (PBRS) is commonly used to incorporate prior knowledge of the task to guide the… view at source ↗
Figure 2
Figure 2. Prompt pipeline for an example image pair from the drawer-open task of the Meta-World environment. The images and goal description are added to the prompt template on the left. The filled template is input to the VLM. The final label is then extracted from the VLM output on the right. After the unguided exploration phase, the main potential learning and policy improvement loop begins. First, we sample pairs of image… view at source ↗
Figure 3
Figure 3. Example observations from Meta-World (top) and Franka Kitchen (bottom). [PITH_FULL_IMAGE:figures/full_fig_p010_3.png] view at source ↗
Figures from the paper (7 more)
Figure 4
Figure 4. Figure 4: Results of Meta-World (button-press, window-open) and Franka Kitchen (mi￾crowave, top-burner, light-switch). VLM-PBRS (in green) outperforms the dense reward baseline in button-press and improves over the sparse reward baseline in all other tasks. We report the mean an…
Figure 5
Figure 5. Figure 5: Results of tasks with at chance VLM label accuracy. VLM-PBRS (in green) improves slightly over the sparse baseline, but given the lack of accurate labels, fails to match the performance of the dense human-designed reward. labels, our method could also decrease the samp…
Figure 6
Figure 6. Figure 6: Ablation results for fixed VLM label accuracies of an oracle labeler in VLM-PBRS in the door-open task of Meta-World. We report the mean discounted evaluation returns and standard error of the mean of 20 repeated training runs [PITH_FULL_IMAGE:figures/full_fig_p016_6.png]
Figure 7
Figure 7. Figure 7: Ablation results for number of queries per VLM labeling batch for VLM-PBRS in the Meta-World environment. Given the negligible performance gap and the lower computational overhead, we adopt 20 VLM labels per batch as our default setting in all experiments instead of th…
Figure 8
Figure 8. Figure 8: Ablation results for choice of loss function for VLM-PBRS in the Meta-World environment. random, the label for a pair is either correct or preferring either image (as the second input image) is equally likely. With the CE loss, multiple repetitions of similar image pai…
Figure 9
Figure 9. Figure 9: The single stage prompt template for VLM-PBRS and the RL-VLM-F baseline used for Meta-World. 22 [PITH_FULL_IMAGE:figures/full_fig_p022_9.png]
Figure 10
Figure 10. Figure 10: The single stage prompt template for VLM-PBRS and the RL-VLM-F baseline used for Franka Kitchen. 23 [PITH_FULL_IMAGE:figures/full_fig_p023_10.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

45 extracted references · 7 canonical work pages

  1. [1]

    Proceedings of the 41st International Conference on Machine Learning , articleno =

    Wang, Yufei and Sun, Zhanyi and Zhang, Jesse and Xian, Zhou and Biyik, Erdem and Held, David and Erickson, Zackory , title =. Proceedings of the 41st International Conference on Machine Learning , articleno =. 2024 , publisher =

    2024

  2. [2]

    Deep Reinforcement Learning from Human Preferences , url =

    Christiano, Paul F and Leike, Jan and Brown, Tom and Martic, Miljan and Legg, Shane and Amodei, Dario , booktitle =. Deep Reinforcement Learning from Human Preferences , url =

  3. [3]

    A Survey of Preference-Based Reinforcement Learning Methods , journal =

    Christian Wirth and Riad Akrour and Gerhard Neumann and Johannes F. A Survey of Preference-Based Reinforcement Learning Methods , journal =. 2017 , volume =

    2017

  4. [4]

    Proceedings of the 38th International Conference on Machine Learning , pages =

    PEBBLE: Feedback-Efficient Interactive Reinforcement Learning via Relabeling Experience and Unsupervised Pre-training , author =. Proceedings of the 38th International Conference on Machine Learning , pages =. 2021 , editor =

    2021

  5. [5]

    2024 , journal=

    Ovis: Structural Embedding Alignment for Multimodal Large Language Model , author=. 2024 , journal=

    2024

  6. [6]

    Qwen3 Technical Report

    Qwen3 Technical Report , author=. arXiv preprint arXiv:2505.09388 , year=

    work page Pith review arXiv

  7. [7]

    Proceedings of the Conference on Robot Learning , pages =

    Meta-World: A Benchmark and Evaluation for Multi-Task and Meta Reinforcement Learning , author =. Proceedings of the Conference on Robot Learning , pages =. 2020 , editor =

    2020

  8. [8]

    arXiv preprint arXiv:1910.11956 , year=

    Relay policy learning: Solving long-horizon tasks via imitation and reinforcement learning , author=. arXiv preprint arXiv:1910.11956 , year=

    work page arXiv 1910

Show all 45 references
  1. [9]

    2020 , eprint=

    D4RL: Datasets for Deep Data-Driven Reinforcement Learning , author=. 2020 , eprint=

    2020

  2. [10]

    Proceedings of the 35th International Conference on Machine Learning , pages =

    Soft Actor-Critic: Off-Policy Maximum Entropy Deep Reinforcement Learning with a Stochastic Actor , author =. Proceedings of the 35th International Conference on Machine Learning , pages =. 2018 , editor =

    2018

  3. [11]

    International Conference on Learning Representations , year=

    Adam: A method for stochastic optimization , author=. International Conference on Learning Representations , year=

  4. [12]

    Navigating Noisy Feedback: Enhancing Reinforcement Learning with Error-Prone Language Models

    Lin, Muhan and Shi, Shuyang and Guo, Yue and Chalaki, Behdad and Tadiparthi, Vaishnav and Moradi Pari, Ehsan and Stepputtis, Simon and Campbell, Joseph and Sycara, Katia P. Navigating Noisy Feedback: Enhancing Reinforcement Learning with Error-Prone Language Models. Findings o...

    2024 doi

  5. [13]

    Second Agent Learning in Open-Endedness Workshop , year=

    Vision-Language Models as a Source of Rewards , author=. Second Agent Learning in Open-Endedness Workshop , year=

  6. [14]

    The Thirteenth International Conference on Learning Representations , year=

    On the Modeling Capabilities of Large Language Models for Sequential Decision Making , author=. The Thirteenth International Conference on Learning Representations , year=

  7. [15]

    Forty-second International Conference on Machine Learning , year=

    Enhancing Rating-Based Reinforcement Learning to Effectively Leverage Feedback from Large Vision-Language Models , author=. Forty-second International Conference on Machine Learning , year=

  8. [16]

    Ghosh, Aritra and Kumar, Himanshu and Sastry, P. S. , title =. Proceedings of the Thirty-First AAAI Conference on Artificial Intelligence , pages =. 2017 , publisher =

    2017

  9. [17]

    Proceedings of the IEEE/CVF International Conference on Computer Vision (ICCV) , month =

    Zhao, Yinuo and Yuan, Jiale and Xu, Zhiyuan and Hao, Xiaoshuai and Zhang, Xinyi and Wu, Kun and Che, Zhengping and Liu, Chi Harold and Tang, Jian , title =. Proceedings of the IEEE/CVF International Conference on Computer Vision (ICCV) , month =. 2025 , pages =

    2025

  10. [18]

    The method of paired comparisons , author=

    Rank analysis of incomplete block designs: I. The method of paired comparisons , author=. Biometrika , volume=

  11. [19]

    Learning to Drive a Bicycle Using Reinforcement Learning and Shaping , year =

    Randl. Learning to Drive a Bicycle Using Reinforcement Learning and Shaping , year =. Proceedings of the Fifteenth International Conference on Machine Learning , pages =

  12. [20]

    Learning to Utilize Shaping Rewards: A New Approach of Reward Shaping , url =

    Hu, Yujing and Wang, Weixun and Jia, Hangtian and Wang, Yixiang and Chen, Yingfeng and Hao, Jianye and Wu, Feng and Fan, Changjie , booktitle =. Learning to Utilize Shaping Rewards: A New Approach of Reward Shaping , url =

  13. [21]

    Self-Supervised Online Reward Shaping in Sparse-Reward Environments , year=

    Memarian, Farzan and Goo, Wonjoon and Lioutikov, Rudolf and Niekum, Scott and Topcu, Ufuk , booktitle=. Self-Supervised Online Reward Shaping in Sparse-Reward Environments , year=

  14. [22]

    Exploration-Guided Reward Shaping for Reinforcement Learning under Sparse Rewards , url =

    Devidze, Rati and Kamalaruban, Parameswaran and Singla, Adish , booktitle =. Exploration-Guided Reward Shaping for Reinforcement Learning under Sparse Rewards , url =

  15. [23]

    Keeping Your Distance: Solving Sparse Reward Tasks Using Self-Balancing Shaped Rewards , url =

    Trott, Alexander and Zheng, Stephan and Xiong, Caiming and Socher, Richard , booktitle =. Keeping Your Distance: Solving Sparse Reward Tasks Using Self-Balancing Shaped Rewards , url =

  16. [24]

    The Twelfth International Conference on Learning Representations , year=

    Motif: Intrinsic Motivation from Artificial Intelligence Feedback , author=. The Twelfth International Conference on Learning Representations , year=

  17. [25]

    arXiv preprint arXiv:2311.02379 , year=

    Accelerating Reinforcement Learning of Robotic Manipulations via Feedback from Large Language Models , author=. arXiv preprint arXiv:2311.02379 , year=

  18. [26]

    International Conference on Machine Learning , pages=

    Zero-shot reward specification via grounded natural language , author=. International Conference on Machine Learning , pages=. 2022 , organization=

    2022

  19. [27]

    International Conference on Machine Learning , pages=

    Learning transferable visual models from natural language supervision , author=. International Conference on Machine Learning , pages=. 2021 , organization=

    2021

  20. [28]

    2023 , editor =

    Ma, Yecheng Jason and Kumar, Vikash and Zhang, Amy and Bastani, Osbert and Jayaraman, Dinesh , booktitle =. 2023 , editor =

    2023

  21. [29]

    RoboCLIP: one demonstration is enough to learn robot policies , year =

    Sontakke, Sumedh A and Zhang, Jesse and Arnold, S\'. RoboCLIP: one demonstration is enough to learn robot policies , year =. Proceedings of the 37th International Conference on Neural Information Processing Systems , articleno =

  22. [30]

    NeurIPS 2023 Foundation Models for Decision Making Workshop , year=

    Vision-Language Models are Zero-Shot Reward Models for Reinforcement Learning , author=. NeurIPS 2023 Foundation Models for Decision Making Workshop , year=

    2023

  23. [31]

    2023 , eprint=

    Language Reward Modulation for Pretraining Reinforcement Learning , author=. 2023 , eprint=

    2023

  24. [32]

    Proceedings of The 4th Annual Learning for Dynamics and Control Conference , pages =

    Can Foundation Models Perform Zero-Shot Task Specification For Robot Manipulation? , author =. Proceedings of The 4th Annual Learning for Dynamics and Control Conference , pages =. 2022 , editor =

    2022

  25. [33]

    and Harada, Daishi and Russell, Stuart J

    Ng, Andrew Y. and Harada, Daishi and Russell, Stuart J. , title =. Proceedings of the Sixteenth International Conference on Machine Learning , pages =. 1999 , isbn =

    1999

  26. [34]

    International Conference on Autonomous Agents and Multiagent Systems,

    Sam Devlin and Daniel Kudenko , title =. International Conference on Autonomous Agents and Multiagent Systems,. 2012 , url =

    2012

  27. [35]

    Reward Shaping in Episodic Reinforcement Learning , year =

    Grze\'. Reward Shaping in Episodic Reinforcement Learning , year =. Proceedings of the 16th Conference on Autonomous Agents and MultiAgent Systems , pages =

  28. [36]

    Theoretical and Empirical Analysis of Reward Shaping in Reinforcement Learning , year=

    Grzes, Marek and Kudenko, Daniel , booktitle=. Theoretical and Empirical Analysis of Reward Shaping in Reinforcement Learning , year=

  29. [37]

    Using incomplete and incorrect plans to shape reinforcement learning in long-sequence sparse-reward tasks , journal=

    M. Using incomplete and incorrect plans to shape reinforcement learning in long-sequence sparse-reward tasks , journal=. 2025 , month=. doi:10.1007/s00521-024-10615-2 , url=

    2025 doi

  30. [38]

    Improving the Effectiveness of Potential-based Reward Shaping in Reinforcement Learning , year =

    M\". Improving the Effectiveness of Potential-based Reward Shaping in Reinforcement Learning , year =. Proceedings of the 24th International Conference on Autonomous Agents and Multiagent Systems , pages =

  31. [39]

    Proceedings of the AAAI Conference on Artificial Intelligence , author=

    DeepSynth: Automata Synthesis for Automatic Task Segmentation in Deep Reinforcement Learning , volume=. Proceedings of the AAAI Conference on Artificial Intelligence , author=. 2021 , month=. doi:10.1609/aaai.v35i9.16935 , number=

    2021 doi

  32. [40]

    A framework for flexibly guiding learning agents , journal =

    Elbarbari, Mahmoud and Delgrange, Florent and Vervlimmeren, Ivo and Efthymiadis, Kyriakos and Vanderborght, Bram and Nowe, Ann , year =. A framework for flexibly guiding learning agents , journal =

  33. [41]

    and Chernova, Sonia , title =

    Suay, Halit Bener and Brys, Tim and Taylor, Matthew E. and Chernova, Sonia , title =. Proceedings of the 2016 International Conference on Autonomous Agents & Multiagent Systems , pages =. 2016 , isbn =

    2016

  34. [42]

    2021 , publisher =

    Wu, Yuchen and Mozifian, Melissa and Shkurti, Florian , title =. 2021 , publisher =. doi:10.1109/ICRA48506.2021.9561333 , booktitle =

    2021 doi

  35. [43]

    and Now\'

    Brys, Tim and Harutyunyan, Anna and Suay, Halit Bener and Chernova, Sonia and Taylor, Matthew E. and Now\'. Reinforcement Learning from Demonstration through Shaping , year =. Proceedings of the 24th International Conference on Artificial Intelligence , pages =

  36. [44]

    Proceedings of the 2023 International Conference on Autonomous Agents and Multiagent Systems , pages =

    Wang, Caroline and Warnell, Garrett and Stone, Peter , title =. Proceedings of the 2023 International Conference on Autonomous Agents and Multiagent Systems , pages =. 2023 , isbn =

    2023

  37. [45]

    Improving Sample Efficiency of Reinforcement Learning With Background Knowledge From Large Language Models , year=

    Zhang, Fuxiang and Li, Junyou and Li, Yi-Chen and Zhang, Zongzhang and Yu, Yang and Ye, Deheng , journal=. Improving Sample Efficiency of Reinforcement Learning With Background Knowledge From Large Language Models , year=

Pith tools

Reviewed June 26, 2026 · model on record in the stance chip above.