Pith. sign in

REVIEW 6 minor 14 cited by

Discovery and Preliminary Characterization of a Third Interstellar Object: 3I/ATLAS

T0 review · 0 major / 6 minor · reviewed 2026-08-06 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read 3I/ATLAS is the third known interstellar object, on an unbound orbit arriving at 58 km/s with a faint coma and a red, primitive surface.

desk verdict 3I/ATLAS is a genuine interstellar discovery; the orbit is ~300 sigma hyperbolic, and the paper's only real weaknesses are minor caveats that don't threaten the central result. read the letter →

arxiv 2507.02757 v3 pith:GRLZONJQ submitted 2025-07-03 astro-ph.EP astro-ph.GAastro-ph.IM

Darryl Z. Seligman , Marco Micheli , Davide Farnocchia , Larry Denneau , John W. Noonan , Henry H. Hsieh , Toni Santana-Ros , John Tonry
show 39 more authors
Katie Auchettl Luca Conversi Maxime Devogèle Laura Faggioli Adina D. Feinstein Marco Fenucci Marin Ferrais Tessa Frincke Michaël Gillon Olivier R. Hainaut Kyle Hart Andrew Hoffman Carrie E. Holt Willem B. Hoogendam Mark E. Huber Emmanuel Jehin Theodore Kareta Jacqueline V. Keane Michael S. P. Kelley Tim Lister Kathleen Mandt Jean Manfroid Dušan Marčeta Karen J. Meech Mohamed Amine Miftah Marvin Morgan Francisco Ocaña Eloy Peña-Asensio Benjamin J. Shappee Robert J. Siverd Aster G. Taylor Michael A. Tucker Richard Wainscoat Robert Weryk James J. Wray Atsuhiro Yaginuma Bin Yang Quanzhi Ye Qicheng Zhang
This is my paper
classification astro-ph.EPastro-ph.GAastro-ph.IM
keywords interstellarobjectscometshyperbolicorbitscometaryactivityreflectancespectroscopylightcurvessmallsolarsystembodies3I/ATLAS
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper announces the discovery and initial characterization of 3I/ATLAS, an object discovered on 2025 July 1 that the authors identify as the third known interstellar object. The identification rests on a barycentric orbital eccentricity of 6.144 ± 0.016 and an incoming speed of 57.942 ± 0.049 km/s, values that place the object on an unbound trajectory through the inner solar system. The paper also reports that 3I/ATLAS is weakly active, with deep images resolving a compact coma, and that its visible/near-infrared reflectance slope of 17.1 ± 0.2 %/100 nm resembles other interstellar objects and primitive solar system bodies. A sympathetic reader should care because a third sample begins to turn interstellar objects from singular curiosities into a population whose number density, composition, and activity states can be measured.

What carries the argument

The load-bearing object is the barycentric orbit solution, computed from astrometry spanning 2025 May 22 to July 6. Eccentricity relative to the solar system barycenter removes the planetary perturbation bias that a heliocentric eccentricity can carry, and e_b > 1 with e_b = 6.144 ± 0.016 is the unambiguous unbound-orbit discriminator. The astrometric solution is anchored by high-precision observations extrapolated to zero aperture to remove inner-coma asymmetry and calibrated against a global reference star catalog. A secondary machinery is the ATLAS detectability-volume model, which converts the single discovery into a local interstellar-object density estimate by computing the volume swept out per year as a function of absolute magnitude.

What would settle it

Re-fit the full astrometric arc with a nongravitational acceleration model, including radial and transverse terms; if the resulting barycentric eccentricity drops to within one sigma of 1, the interstellar classification would not be secure. The same re-fit would also test whether the reported incoming asymptote of right ascension about 295 degrees and declination about -19 degrees changes materially.

Watch

Extended reading notes

Core claim

The paper claims that C/2025 N1 (ATLAS), discovered on 2025 July 1, is on a barycentric hyperbolic orbit with eccentricity e_b = 6.144 ± 0.016 and incoming speed v∞ = 57.942 ± 0.049 km/s, making it the third known interstellar object after 1I/‘Oumuamua and 2I/Borisov. The object is weakly cometary: stacked images from large ground-based telescopes show a compact coma extending at least 4 arcseconds, and photometry over a roughly four-day span shows little brightness variation, with amplitudes below about 0.2 magnitudes. Its visible/near-infrared reflectance spectrum is featureless and moderately red, with a slope of 17.1 ± 0.2 %/100 nm, comparable to 2I/Borisov, D-type asteroids, and the redder end of 1I/‘Oumuamua measurements; pre-discovery colors suggest the nucleus may be closer to solar in color while the redder signal comes from ejected dust.

Load-bearing premise

The orbit is treated as purely gravitational even though the object is demonstrably active, so unmodeled outgassing forces could bias the reported incoming speed and direction, although the large eccentricity would likely still imply an interstellar origin.

Editorial extensions

If this is right

  • 3I/ATLAS is the second active interstellar comet after 2I/Borisov, showing that interstellar objects can arrive both active and inactive.
  • Its spectral slope places it with moderately red primitive bodies, supporting the view that interstellar objects share surface properties with the most primitive solar system small bodies.
  • The ATLAS detectability model implies a local interstellar-object density of roughly 3×10^-4 au^-3 and a detection rate near 0.2 per year for objects as bright as 3I/ATLAS.
  • The object is observable from Earth through early September 2025 and again from late November 2025, while its perihelion passage is well placed for Mars-orbiting spacecraft at a close approach of 0.19 au.
  • The small light-curve amplitude over four days contrasts sharply with 1I/‘Oumuamua’s 3.5-magnitude swings, though coma dilution may hide rotational modulation.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Because a coma can dilute rotational modulation, the small light-curve amplitude does not yet constrain the nucleus shape or spin; a coma-free nucleus measurement later in the apparition could.
  • If the red measured color is dominated by ejected dust, the pre-discovery g'−r' colors near 0.42–0.44, which are close to solar, may be the better guide to the nucleus surface composition.
  • A third sample with a high incoming velocity of about 58 km/s strengthens the view that interstellar objects arrive from multiple kinematic populations; a larger sample from upcoming wide-field surveys could determine whether such high speeds are common or rare.
  • The apparent discovery of two relatively bright objects near H ~ 13 and no faint ones over a decade suggests either a size distribution shallower than the 1I/‘Oumuamua-based estimate or strong discovery bias against smaller interstellar objects; the paper's own density estimate is explicitly sensitive to phase-function and coma assumptions.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

0 major / 6 minor

Summary. The paper reports the discovery and initial characterization of 3I/ATLAS (C/2025 N1), identified as the third known interstellar object. From an 18-day astrometric arc extended by precovery detections to 2025 May 22, and from follow-up astrometry obtained with ATLAS, LCO, TBT, and VLT, the authors derive a strongly hyperbolic heliocentric orbit (e = 6.13, q = 1.36 au, i = 175 deg), with a barycentric eccentricity e_b = 6.144 ± 0.016 and an incoming velocity v_inf = 57.942 ± 0.049 km/s. Deep CFHT and VLT imaging resolves a compact coma; time-series photometry over about four days shows no large-amplitude variability; griz colors and a SNIFS spectrum give a red spectral slope of 17.1 ± 0.2 %/100 nm. The paper closes with an order-of-magnitude estimate of the local interstellar-object density and notes that Mars-orbiting spacecraft may be able to observe the object near perihelion.

Significance. If the result holds, this is the third interstellar object and the second active one, providing a valuable new data point for population statistics and for understanding the physical diversity of interstellar small bodies. The central classification rests on direct astrometry from multiple observatories, including Gaia-DR3-calibrated VLT astrometry with a zero-aperture correction, and is not a circular or model-dependent claim. The paper also makes its data and Python scripts available, which is a clear strength. The activity detection and red spectral slope are plausible but carry acknowledged caveats from coma-contaminated photometry and uncorrected light-curve geometry; these caveats do not affect the interstellar classification. The Section 4 density estimate is explicitly model-dependent and should be treated as preliminary.

minor comments (6)
  1. [Section 2.2 and Table 1] The orbit solution is presented without discussing nongravitational acceleration, even though Section 3.1 demonstrates that the object is active. Because the object has a coma, the quoted v_inf and incoming asymptote direction are formally fitted under a purely gravitational model; the authors should add a sentence quantifying the expected effect of nongravitational acceleration (or state that an acceleration fit was attempted) to reassure readers that e_b = 6.144 remains robust. This is a caveat on secondary characterization quantities, not on the interstellar classification itself.
  2. [Section 4, second paragraph] The sentence 'In this case since HV of 3I/ATLAS was measured when active this limiting search volume corresponds to the absolute brightness of the inert nucleus' appears to state the opposite of what is intended. If HV is measured during activity, the brightness includes coma light, so the detection volume corresponds to the combined nucleus-plus-coma brightness; the nucleus-only volume would be smaller. Please rephrase or clarify the intended logic.
  3. [Section 3.2 and Figure 6] The compiled light curve combines data from multiple telescopes, filters, apertures, and photometric methods and is not corrected for changing heliocentric/geocentric distance or solar phase angle. The claim of 'little brightness variation ≲ 0.2 mag' should be explicitly presented as an upper limit on the coma-contaminated brightness variation, since the uncorrected geometric and methodological offsets are of comparable magnitude.
  4. [Section 3.4 and Figure 7] The spectroscopic slope of 17.1 ± 0.2 %/100 nm and the color-derived slope of approximately 18 %/100 nm are quoted with very different precisions; as written, the two values appear formally inconsistent. Please report an uncertainty for the color-derived slope or explain why the difference is within systematic errors.
  5. [Figure 4 caption] The caption refers to 'the VLT image (Figure 3a)', but the VLT composite is Figure 3b; Figure 3a is the CFHT stack. Please correct the cross-reference.
  6. [Title] The title in the manuscript header reads '3I/A TLAS' with an erroneous space; please fix this typographical error.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: the interstellar classification and physical characterization derive directly from astrometry, imaging, and spectroscopy, not from the paper's own assumptions.

full rationale

The discovery claim rests on a direct astrometric orbit determination: Section 2.2 reports barycentric eccentricity e_b = 6.144 ± 0.016 and incoming velocity v_inf = 57.942 ± 0.049 km/s from astrometry spanning 2025 May 22 to July 6, with Gaia DR3 as the reference catalog. These are measured orbital elements, not outputs of a model that assumes interstellar origin. The activity detection is likewise direct: CFHT and VLT images resolve a coma, and the photometric profile shows an excess over stellar Point Spread Functions (Section 3.1). Colors and spectral slope come from independent photometry and spectroscopy calibrated to standard catalogs. The population density estimate in Section 4 is an explicit extrapolation using an ATLAS detection-volume model, and the paper itself flags the sensitivity to the assumed phase function and activity state; it does not retroactively define the object's interstellar nature. Self-citations appear in the introduction and discussion (e.g., Micheli et al. 2018; Seligman et al. 2023, 2024; Taylor & Seligman 2025), but none is load-bearing for the central classification; they provide context on nongravitational acceleration and prior interstellar objects. The lack of a fitted nongravitational acceleration is a plausible modeling caveat for secondary quantities, but it is not circularity: the reported excess kinetic energy is enormous and would not be erased by realistic outgassing, and the paper explicitly encourages future nongravitational fits. The derivation chain is therefore self-contained and observationally grounded, with no step that reduces to its own input by construction.

Assumptions & free parameters 4 free parameters · 3 assumptions · 0 invented entities

The central discovery rests on astrometry and imaging. The main hand-selected inputs are the detection-model parameters used for the local density estimate, which the authors themselves flag as uncertain. No new physical entities are introduced.

free parameters (4)
  • ATLAS detection model limiting magnitude m_lim = ~19
    Hand-selected in Section 4 for the detection-volume model; changes the local density estimate.
  • Phase function parameter G = 0.15
    Assumed in Sections 3.1 and 4 to compute H_V and detection volumes; could be inappropriate for an active comet.
  • Detection and crossing speed = 50 km/s
    Assumed in Section 4 for trailing losses and volume crossing; close to, but not equal to, the measured v_inf ~58 km/s.
  • Geometric albedo p_V = 0.05
    Assumed in Section 3.1 to convert H_V to a nucleus radius; the paper explicitly treats the result as an upper limit.
assumptions (3)
  • domain assumption Orbital fit assumes purely gravitational motion with no nongravitational acceleration terms.
    The object is active (Section 3.1), so outgassing forces could alter the astrometric solution; the paper does not fit or discuss nongravitational parameters in Section 2.2.
  • domain assumption ATLAS detectability model assumes a G=0.15 phase function, a weather and moon averaged limiting magnitude of m_lim ~19, and a crossing speed of 50 km/s.
    Section 4 uses these hand-picked inputs to estimate local density; the paper itself notes the phase function may be inappropriate and could make the density estimate significantly incorrect.
  • domain assumption Photometric absolute magnitudes are computed assuming a standard asteroidal phase function with G=0.15 and solar colors.
    Used to convert ZTF g' and r' magnitudes to H_V in Section 3.1; the object's true phase function and coma contribution are unknown.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Discovery and Preliminary Characterization of a Third Interstellar Object: 3I/ATLAS." pith.science (2026). https://pith.science/paper/GRLZONJQ

@misc{pith2026250702757,
  author       = {Pith},
  title        = {Pith review of: Discovery and Preliminary Characterization of a Third Interstellar Object: 3I/ATLAS},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/GRLZONJQ}},
  note         = {Machine review of arXiv:2507.02757}
}
abstract

We report initial observations aimed at the characterization of a third interstellar object. This object, 3I/ATLAS or C/2025 N1 (ATLAS), was discovered on 2025 July 1 UT and has an orbital eccentricity of $e\sim6.1$, perihelion of $q\sim 1.36$ au, inclination of $\sim175^\circ$, and hyperbolic velocity of $V_\infty\sim 58$ km s$^{-1}$. We report deep stacked images obtained using the Canada-France-Hawaii Telescope and the Very Large Telescope that resolve a compact coma. Using images obtained from several smaller ground-based telescopes, we find minimal light curve variation for the object over a $\sim4$ day time span. The visible/near-infrared spectral slope of the object is 17.1$\pm$0.2 %/100 nm, comparable to other interstellar objects and primitive solar system small bodies (comets and D-type asteroids). 3I/ATLAS will be observable through early September 2025, then unobservable by Earth-based observatories near perihelion due to low solar elongation. It will be observable again from the ground in late November 2025. Although this limitation unfortunately prohibits detailed Earth-based observations at perihelion when the activity of 3I/ATLAS is likely to peak, spacecraft at Mars could be used to make valuable observations at this time.

Figures

Figures reproduced from arXiv: 2507.02757 by the authors.

Figure 1
Figure 1. Cutout images from the first and fourth discov￾ery observations of 3I/ATLAS from the ATLAS Chile, span￾ning approximately one hour. 3I/ATLAS is moving at 0.49 deg/day against the stellar background. The cardinal direc￾tions and direction of motion are indicated with arrows, and 3I/ATLAS is identified within the red circle. (a) Un-back￾ground subtracted image from 05:15:11 UT; (b) Un-back￾ground subtracted image from… view at source ↗
Figure 2
Figure 2. Heliocentric orbit (ECLIPJ2000) of 1I/‘Oumuamua, 2I/Borisov, 3I/ATLAS, Earth, Mars, and Jupiter. Black lines represent the orbital path of each object; gray lines represent when the interstellar object is below-ecliptic. We highlight the location of the Sun (yellow) and the orbital paths of Earth (blue), Mars (red), and Jupiter (green). Large filled markers represent where the respective colored planet was when the … view at source ↗
Figure 3
Figure 3. [PITH_FULL_IMAGE:figures/full_fig_p005_3.png] view at source ↗
Figures from the paper (5 more)
Figure 4
Figure 4. Figure 4: Photometric profile of the VLT image (Figure 3a). The individual pixels are represented by black dots; average in annuli by blue circles. The red line is the average stellar profile measured on 10 nearby well-exposed stars. 6.0 5.8 5.6 5.4 5.2 5.0 r (au) 10 15 20 25 30…
Figure 5
Figure 5. Figure 5: Absolute magnitudes computed from ZTF pre￾covery data published in MPEC 2025-N51 from 2025 May 22 to June 18 (black filled dots). The median HV and standard deviation of data are shown by a dashed horizontal line and dotted horizontal lines, respectively. No uncertaint…
Figure 6
Figure 6. Figure 6: Compiled light curve of 3I/ATLAS incorporating r ′ -band data from the LCO 0.35-meter telescopes, Faulkes Telescope North, Faulkes Telescope South, and the Telescope Joan Or´o, Johnson-Cousins Rc-band data from the TRAP￾PIST-North and -South telescopes, and o-band data…
Figure 7
Figure 7. Figure 7: The g ′ ,r ′ ,i ′ ,z ′ colors of 3I/ATLAS obtained with FTN converted to a solar reflectivity as well as the reflectance spectrum obtained with SNIFS on the UH 2.2-meter at Mau￾nakea normalized at 5500 ˚A are plotted in comparison to 1I/‘Oumuamua (Q.-Z. Ye et al. 2017)…
Figure 8
Figure 8. Figure 8: The volume in which ATLAS can detect an ob￾ject is plotted as a function of H magnitude (red). The ra￾tio of volume and crossing time (blue) is approximately the product of detection cross section and velocity. When the visibility time (green) becomes less than ∼ 0.1 y…

Discussion (0). Sign in to comment.

Forward citations

Cited by 14 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Extreme Negative Polarisation of New Interstellar Comet 3I/ATLAS

    astro-ph.EP 2025-09 conditional novelty 7.0 of 10

    First polarimetric observations of interstellar comet 3I/ATLAS show an unprecedentedly deep and narrow negative polarization branch, with a minimum near -2.7% at about 7 degrees and inversion at 17 degrees.

  2. Very Large Telescope observations of interstellar comet 3I/ATLAS III: High-resolution monitoring of CN and forbidden oxygen emission across the perihelion passage with ESPRESSO

    astro-ph.EP 2026-07 conditional novelty 6.0 of 10

    3I/ATLAS becomes progressively water-dominated near perihelion, with CN production falling as r_h^-4.62 on the inbound leg and a green-to-red oxygen ratio comparable to 2I/Borisov.

  3. Precovery Observations of 3I/ATLAS from TESS Suggests Possible Distant Activity

    astro-ph.EP 2025-07 conditional novelty 6.0 of 10

    Archival TESS images show 3I/ATLAS was brighter than distance effects alone can explain, implying possible cometary activity at ~6 au from the Sun.

  4. Detecting dark objects in the Solar System with Gravitational Wave observatories

    gr-qc 2025-07 conditional novelty 6.0 of 10

    DECIGO could detect compact dark matter objects with masses 10^7 to 10^11 g flying through the solar system via their gravitational perturbation of the detector test masses.

  5. Assessing interstellar comet 3I/ATLAS with the 10.4 m Gran Telescopio Canarias and the Two-meter Twin Telescope

    astro-ph.EP 2025-07 conditional novelty 6.0 of 10

    3I/ATLAS, the third interstellar object, has a red TNO-like spectrum, an active dust coma, a rotation period of 16.79 hours, and a kinematic trace toward the Galactic thin disk.

  6. Near-Discovery Observations of Interstellar Comet 3I/ATLAS with the NASA Infrared Telescope Facility

    astro-ph.EP 2025-07 accept novelty 6.0 of 10

    New observations of interstellar comet 3I/ATLAS produce the first near-infrared spectrum, showing a red slope that turns neutral at longer wavelengths, no water ice absorption, and a model-dependent upper limit of <7%...

  7. From a Different Star: 3I/ATLAS in the context of the \={O}tautahi-Oxford interstellar object population model

    astro-ph.EP 2025-07 conditional novelty 6.0 of 10

    3I/ATLAS's incoming speed and direction fit the Otautahi-Oxford model, which predicts it is an old (likely over 7.6 Gyr), water-rich object with no kinematic link to 1I/Oumuamua or 2I/Borisov.

  8. Palomar and Apache Point Spectrophotometry of Interstellar Comet 3I/ATLAS

    astro-ph.EP 2025-07 conditional novelty 5.0 of 10

    3I/ATLAS, the third interstellar object, has a red spectral slope of about 19%/100 nm from 420 to 700 nm and a neutral 6%/100 nm slope from 700 to 1000 nm, with no obvious C2 or CO+ emission.

  9. The Kinematic Age of 3I/ATLAS and its Implications for Early Planet Formation

    astro-ph.EP 2025-07 conditional novelty 5.0 of 10

    3I/ATLAS is likely an old, active comet about 2 km across, and its high speed implies it formed roughly 3 to 11 billion years ago around a low-metallicity star.

  10. X-SHOOTER Spectrum of Comet 3I/ATLAS: Insights into a Distant Interstellar Visitor

    astro-ph.EP 2025-07 conditional novelty 5.0 of 10

    3I/ATLAS, the third known interstellar visitor, shows a red reflectance spectrum and no detectable OH or CN emission at 4.4 AU, with derived upper limits.

  11. Snapshot of a new interstellar comet: 3I/ATLAS has a red and featureless spectrum

    astro-ph.EP 2025-07 accept novelty 5.0 of 10

    The interstellar comet 3I/ATLAS has a red, featureless optical spectrum with no detected gas emission, indicating a dusty coma during early observations.

  12. NSF-DOE Vera C. Rubin Observatory Observations of Interstellar Comet 3I/ATLAS (C/2025 N1)

    astro-ph.EP 2025-07 accept novelty 4.0 of 10

    Rubin Observatory delivers the earliest large-telescope astrometry and grizy photometry of interstellar comet 3I/ATLAS, including colors and a dust-to-nucleus cross-section ratio lower limit.

  13. Comment on "Discovery and Preliminary Characterization of a Third Interstellar Object: 3I/ATLAS" [arXiv:2507.02757]

    astro-ph.EP 2025-07 conditional novelty 4.0 of 10

    The brightness-based size of interstellar object 3I/ATLAS conflicts with the estimated interstellar mass budget, so the object must have a small core or be a member of a very rare population.

  14. From Extraterrestrial Microbes to Alien Intelligence: Rebalancing Astronomical Research Priorities

    astro-ph.IM 2025-07 unverdicted novelty 2.0 of 10

    An advocacy essay claiming the exclusion of extraterrestrial intelligence research from federal astronomy funding reflects institutional bias and proposes rebalancing priorities toward technosignatures and interstella...

Reference graph

Works this paper leans on

97 extracted references · 4 canonical work pages · cited by 14 Pith papers

  1. [1]

    , " * write output.state after.block = add.period write newline

    ENTRY address archivePrefix author booktitle chapter doi edition editor eprint howpublished institution journal key month number organization pages publisher school series title misctitle type volume year version url label extra.label sort.label short.list INTEGERS output.state before.all mid.sentence after.sentence after.block FUNCTION init.state.consts ...

  2. [2]

    write newline

    " write newline "" before.all 'output.state := FUNCTION format.url url empty "" new.block "" url * "" * if FUNCTION format.eprint eprint empty "" archivePrefix empty "" archivePrefix "arXiv" = new.block " " eprint * " " * new.block " " eprint * " " * if if if FUNCTION format.doi doi empty "" " " doi * " " * if FUNCTION format.pid doi empty eprint empty ur...

  3. [3]

    oh =Š 0eBPQ P j BX J) ŏ*Q Ў ( 5?Oe [GX f͹8=7o zQ O2GRA Ў ( 5 66Ў ( 5?OB4o aS TC^! mYEJ ر

    thebibliography [1] 20pt to REFERENCES 6pt =0pt \@twocolumntrue 12pt -12pt 10pt plus 3pt =0pt =0pt =1pt plus 1pt =0pt =0pt -12pt =13pt plus 1pt =20pt =13pt plus 1pt \@M =10000 =-1.0em =0pt =0pt 0pt =0pt =1.0em @enumiv\@empty 10000 10000 `\.\@m \@noitemerr \@latex@warning Empty `thebibliography' environment \@ifnextchar \@reference \@latexerr Missing key o...

    2017

  4. [4]

    R., Serra-Ricart , M., Licandro , J., et al

    Alarcon , M. R., Serra-Ricart , M., Licandro , J., et al. 2025, title Deep g'-band Imaging of Interstellar Comet 3I/ATLAS from the Two-meter Twin Telescope (TTT) , , The Astronomer's Telegram, No. 17264 https://www.astronomerstelegram.org/?read=17264

    2025

  5. [5]

    Almeida-Fernandes , F., & Rocha-Pinto , H. J. 2018, title A kinematical age for the interstellar object 1I/`Oumuamua , , 480, 4903, 10.1093/mnras/sty2202

    doi:10.1093/mnras/sty2202 2018

  6. [6]

    2021, title Activity of the first interstellar comet 2I/Borisov around perihelion: results from Indian observatories , , 502, 3491, 10.1093/mnras/stab084

    Aravind , K., Ganesh , S., Venkataramani , K., et al. 2021, title Activity of the first interstellar comet 2I/Borisov around perihelion: results from Indian observatories , , 502, 3491, 10.1093/mnras/stab084

    doi:10.1093/mnras/stab084 2021

  7. [7]

    2021, title Unusual polarimetric properties for interstellar comet 2I/Borisov , Nature Communications, 12, 1797, 10.1038/s41467-021-22000-x

    Bagnulo , S., Cellino , A., Kolokolova , L., et al. 2021, title Unusual polarimetric properties for interstellar comet 2I/Borisov , Nature Communications, 12, 1797, 10.1038/s41467-021-22000-x

    doi:10.1038/s41467-021-22000-x 2021

  8. [8]

    T., Opitom , C., Fitzsimmons , A., et al

    Bannister , M. T., Opitom , C., Fitzsimmons , A., et al. 2020, title Interstellar comet 2I/Borisov as seen by MUSE: C _2 , NH _2 and red CN detections , arXiv e-prints, arXiv:2001.11605. 2001.11605

    arXiv 2020

Show all 97 references
  1. [9]

    C., Kulkarni , S

    Bellm , E. C., Kulkarni , S. R., Graham , M. J., et al. 2019, title The Zwicky Transient Facility: System Overview, Performance, and First Results , , 131, 018002, 10.1088/1538-3873/aaecbe

    2019 doi

  2. [10]

    Belton , M. J. S., Hainaut , O. R., Meech , K. J., et al. 2018, title The Excited Spin State of 1I/2017 U1 Oumuamua , ApJL, 856, L21, 10.3847/2041-8213/aab370

    2018 doi

  3. [11]

    J., et al

    Belyakov , M., Fremling , C., Graham , M. J., et al. 2025, title Palomar and Apache Point Spectrophotometry of Interstellar Comet 3I/ATLAS , arXiv e-prints, arXiv:2507.11720. 2507.11720

    2025 arXiv

  4. [12]

    B., & Seligman , D

    Bergner , J. B., & Seligman , D. Z. 2023, title Acceleration of 1I/`Oumuamua from radiolytically produced H _ 2 in H _ 2 O ice , , 615, 610, 10.1038/s41586-022-05687-w

    2023 doi

  5. [13]

    Binzel , R. P. 1992, title The optical spectrum of 5145 Pholus , , 99, 238, 10.1016/0019-1035(92)90185-A

    1992 doi

  6. [14]

    2024, in Comets III, ed

    Biver , N., Dello Russo , N., Opitom , C., & Rubin , M. 2024, in Comets III, ed. K. J. Meech , M. R. Combi , D. Bockel \'e e-Morvan , S. N. Raymodn , & M. E. Zolensky ( University of Arizona Press ), 459--498

    2024

  7. [15]

    W., Feldman , P

    Bodewits , D., Noonan , J. W., Feldman , P. D., et al. 2020, title The carbon monoxide-rich interstellar comet 2I/Borisov , Nature Astronomy, 4, 867, 10.1038/s41550-020-1095-2

    2020 doi

  8. [16]

    T., Sato , H., et al

    Borisov , G., Durig , D. T., Sato , H., et al. 2019, title Comet C/2019 Q4 (Borisov) , Central Bureau Electronic Telegrams, 4666, 1

    2019

  9. [17]

    2003, in , Vol

    Boulade , O., Charlot , X., Abbon , P., et al. 2003, in , Vol. 4841, Instrument Design and Performance for Optical/Infrared Ground-based Telescopes, 72--81, 10.1117/12.459890

    2003 doi

  10. [18]

    1989, in Asteroids II, 524--556

    Bowell , E., Hapke , B., Domingue , D., et al. 1989, in Asteroids II, 524--556

    1989

  11. [19]

    A., Milam , S

    Cordiner , M. A., Milam , S. N., Biver , N., et al. 2020, title Unusually high CO abundance of the first active interstellar comet , Nature Astronomy, 4, 861, 10.1038/s41550-020-1087-2

    2020 doi

  12. [20]

    2020, title Dust Environment Model of the Interstellar Comet 2I/Borisov , , 893, L12, 10.3847/2041-8213/ab8455

    Cremonese , G., Fulle , M., Cambianica , P., et al. 2020, title Dust Environment Model of the Interstellar Comet 2I/Borisov , , 893, L12, 10.3847/2041-8213/ab8455

    2020 doi

  13. [21]

    R., et al

    de la Fuente Marcos , R., Licandro , J., Alarcon , M. R., et al. 2025, title Assessing interstellar comet 3I/ATLAS with the 10.4 m Gran Telescopio Canarias and the Two-meter Twin Telescope , arXiv e-prints, arXiv:2507.12922. 2507.12922

    2025 arXiv

  14. [22]

    2020, title Visible and near-infrared observations of interstellar comet 2I/Borisov with the 10.4-m GTC and the 3.6-m TNG telescopes , , 495, 2053, 10.1093/mnras/staa1190

    de Le \'o n , J., Licandro , J., de la Fuente Marcos , C., et al. 2020, title Visible and near-infrared observations of interstellar comet 2I/Borisov with the 10.4-m GTC and the 3.6-m TNG telescopes , , 495, 2053, 10.1093/mnras/staa1190

    2020 doi

  15. [23]

    E., Binzel , R

    DeMeo , F. E., Binzel , R. P., Slivan , S. M., & Bus , S. J. 2009, title An extension of the Bus asteroid taxonomy into the near-infrared , , 202, 160, 10.1016/j.icarus.2009.02.005

    2009 doi

  16. [24]

    2025, title 3I/ATLAS = C/2025 N1 (ATLAS) , MPEC

    Denneau , L., Siverd , R., Tonry , J., et al. 2025, title 3I/ATLAS = C/2025 N1 (ATLAS) , MPEC

    2025

  17. [25]

    J., & Jackson, A

    Desch, S. J., & Jackson, A. P. 2021, title 1I/‘Oumuamua as an N2 ice fragment of an exo-pluto surface II: Generation of N2 ice fragments and the origin of ‘Oumuamua, Journal of Geophysical Research: Planets, e2020JE006807

    2021

  18. [26]

    J., & Jackson , A

    Desch , S. J., & Jackson , A. P. 2022, title Some Pertinent Issues for Interstellar Panspermia Raised after the Discovery of 1I/`Oumuamua , Astrobiology, 22, 1400, 10.1089/ast.2021.0199

    2022

  19. [27]

    A., & Tonry , J

    Do , A., Tucker , M. A., & Tonry , J. 2018, title Interstellar Interlopers: Number Density and Origin of Oumuamua-like Objects , , 855, L10, 10.3847/2041-8213/aaae67

    2018 doi

  20. [28]

    Z., Granvik , M., et al

    Farnocchia , D., Seligman , D. Z., Granvik , M., et al. 2023, title (523599) 2003 RM: The Asteroid that Wanted to be a Comet , , 4, 29, 10.3847/PSJ/acb25b

    2023 doi

  21. [29]

    Feng , F., & Jones , H. R. A. 2018, title Oumuamua as a Messenger from the Local Association , , 852, L27, 10.3847/2041-8213/aaa404

    2018 doi

  22. [30]

    2024, in Comets III, ed

    Fitzsimmons , A., Meech , K., Matr \`a , L., & Pfalzner , S. 2024, in Comets III, ed. K. J. Meech , M. R. Combi , D. Bockel \'e e-Morvan , S. N. Raymodn , & M. E. Zolensky , 731--766

    2024

  23. [31]

    2018, title Spectroscopy and thermal modelling of the first interstellar object 1I/2017 U1 `Oumuamua , Nature Astronomy, 2, 133, 10.1038/s41550-017-0361-4

    Fitzsimmons , A., Snodgrass , C., Rozitis , B., et al. 2018, title Spectroscopy and thermal modelling of the first interstellar object 1I/2017 U1 `Oumuamua , Nature Astronomy, 2, 133, 10.1038/s41550-017-0361-4

    2018 doi

  24. [32]

    J., et al

    Fitzsimmons , A., Hainaut , O., Meech , K. J., et al. 2019, title Detection of CN Gas in Interstellar Object 2I/Borisov , , 885, L9, 10.3847/2041-8213/ab49fc

    2019 doi

  25. [33]

    G., Luu , J., & Toussaint , R

    Flekk y , E. G., Luu , J., & Toussaint , R. 2019, title The Interstellar Object Oumuamua as a Fractal Dust Aggregate , , 885, L41, 10.3847/2041-8213/ab4f78

    2019 doi

  26. [34]

    A., Magnier , E

    Flewelling , H. A., Magnier , E. A., Chambers , K. C., et al. 2020, title The Pan-STARRS1 Database and Data Products , , 251, 7, 10.3847/1538-4365/abb82d

    2020 doi

  27. [35]

    C., Pravec , P., Fitzsimmons , A., et al

    Fraser , W. C., Pravec , P., Fitzsimmons , A., et al. 2018, title The tumbling rotational state of 1I/`Oumuamua , Nature Astronomy, 2, 383, 10.1038/s41550-018-0398-z

    2018 doi

  28. [36]

    Gaia Collaboration , Vallenari , A., Brown , A. G. A., et al. 2023, title Gaia Data Release 3. Summary of the content and survey properties , , 674, A1, 10.1051/0004-6361/202243940

    2023 doi

  29. [37]

    2017, title Origin of Interstellar Object A/2017 U1 in a Nearby Young Stellar Association? , RNAAS, 1, 13, 10.3847/2515-5172/aa9851

    Gaidos , E., Williams , J., & Kraus , A. 2017, title Origin of Interstellar Object A/2017 U1 in a Nearby Young Stellar Association? , RNAAS, 1, 13, 10.3847/2515-5172/aa9851

    2017 doi

  30. [38]

    J., Kulkarni , S

    Graham , M. J., Kulkarni , S. R., Bellm , E. C., et al. 2019, title The Zwicky Transient Facility: Science Objectives , , 131, 078001, 10.1088/1538-3873/ab006c

    2019 doi

  31. [39]

    2020, title Initial characterization of interstellar comet 2I/Borisov , Nature Astronomy, 4, 53, 10.1038/s41550-019-0931-8

    Guzik , P., Drahus , M., Rusek , K., et al. 2020, title Initial characterization of interstellar comet 2I/Borisov , Nature Astronomy, 4, 53, 10.1038/s41550-019-0931-8

    2020 doi

  32. [40]

    2020, title The Dynamics of Interstellar Asteroids and Comets within the Galaxy: An Assessment of Local Candidate Source Regions for 1I/’Oumuamua and 2I/Borisov, , 159, 147

    Hallatt, T., & Wiegert, P. 2020, title The Dynamics of Interstellar Asteroids and Comets within the Galaxy: An Assessment of Local Candidate Source Regions for 1I/’Oumuamua and 2I/Borisov, , 159, 147

    2020

  33. [41]

    2025, title Is the Interstellar Object 3I/ATLAS Alien Technology? , arXiv e-prints, arXiv:2507.12213

    Hibberd , A., Crowl , A., & Loeb , A. 2025, title Is the Interstellar Object 3I/ATLAS Alien Technology? , arXiv e-prints, arXiv:2507.12213. 2507.12213

    2025

  34. [42]

    2006, title The colours of the Sun , , 367, 449, 10.1111/j.1365-2966.2005.09832.x

    Holmberg , J., Flynn , C., & Portinari , L. 2006, title The colours of the Sun , , 367, 449, 10.1111/j.1365-2966.2005.09832.x

    2006

  35. [43]

    J., Dorsey, R

    Hopkins, M. J., Dorsey, R. C., Forbes, J. C., et al. 2025, title From a Different Star: 3I/ATLAS in the context of the \= O tautahi-Oxford interstellar object population model, 2507.05318

    2025 arXiv

  36. [44]

    Hsieh , C.-H., Laughlin , G., & Arce , H. G. 2021, title Evidence Suggesting That 'Oumuamua Is the 30 Myr Old Product of a Molecular Cloud , , 917, 20, 10.3847/1538-4357/ac0729

    2021 doi

  37. [45]

    Hui , M.-T., Ye , Q.-Z., F \"o hring , D., Hung , D., & Tholen , D. J. 2020, title Physical Characterization of Interstellar Comet 2I/2019 Q4 (Borisov) , , 160, 92, 10.3847/1538-3881/ab9df8

    2020 doi

  38. [46]

    P., & Desch, S

    Jackson, A. P., & Desch, S. J. 2021, title 1I/‘Oumuamua as an N2 ice fragment of an exo-Pluto surface: I. Size and Compositional Constraints, Journal of Geophysical Research: Planets, e2020JE006706

    2021

  39. [47]

    2011, title TRAPPIST: TRAnsiting planets and PlanetesImals small telescope, The Messenger, 145

    Jehin, E., Gillon, M., Queloz, D., et al. 2011, title TRAPPIST: TRAnsiting planets and PlanetesImals small telescope, The Messenger, 145

    2011

  40. [48]

    2019, title Initial Characterization of Interstellar Comet 2I/2019 Q4 (Borisov) , , 886, L29, 10.3847/2041-8213/ab530b

    Jewitt , D., & Luu , J. 2019, title Initial Characterization of Interstellar Comet 2I/2019 Q4 (Borisov) , , 886, L29, 10.3847/2041-8213/ab530b

    2019 doi

  41. [49]

    2025, title Interstellar Interloper C/2025 N1 is Active , , The Astronomer's Telegram, No

    Jewitt , D., & Luu , J. 2025, title Interstellar Interloper C/2025 N1 is Active , , The Astronomer's Telegram, No. 17263 https://www.astronomerstelegram.org/?read=17263

    2025

  42. [50]

    2017, title Interstellar Interloper 1I/2017 U1: Observations from the NOT and WIYN Telescopes , ApJL, 850, L36, 10.3847/2041-8213/aa9b2f

    Jewitt , D., Luu , J., Rajagopal , J., et al. 2017, title Interstellar Interloper 1I/2017 U1: Observations from the NOT and WIYN Telescopes , ApJL, 850, L36, 10.3847/2041-8213/aa9b2f

    2017 doi

  43. [51]

    Jewitt , D., & Seligman , D. Z. 2023, title The Interstellar Interlopers , , 61, 197, 10.1146/annurev-astro-071221-054221

    2023 doi

  44. [52]

    L., Chesley , S

    Jones , R. L., Chesley , S. R., Connolly , A. J., et al. 2009, title Solar System Science with LSST , Earth Moon and Planets, 105, 101, 10.1007/s11038-009-9305-z

    2009 doi

  45. [53]

    K., & Ammon , K

    Jordi , K., Grebel , E. K., & Ammon , K. 2006, title Empirical color transformations between SDSS photometry and other photometric systems , , 460, 339, 10.1051/0004-6361:20066082

    2006 doi

  46. [54]

    W., Harris , W

    Kareta , T., Noonan , J. W., Harris , W. M., & Springmann , A. 2023, title Ice, Ice, Maybe? Investigating 46P/Wirtanen's Inner Coma for Icy Grains , , 4, 85, 10.3847/PSJ/accc28

    2023 doi

  47. [55]

    W., et al

    Kareta , T., Andrews , J., Noonan , J. W., et al. 2020, title Carbon Chain Depletion of 2I/Borisov , , 889, L38, 10.3847/2041-8213/ab6a08

    2020 doi

  48. [56]

    2025, title Near-Discovery Observations of Interstellar Comet 3I/ATLAS with the NASA Infrared Telescope Facility , arXiv e-prints, arXiv:2507.12234

    Kareta , T., Champagne , C., McClure , L., et al. 2025, title Near-Discovery Observations of Interstellar Comet 3I/ATLAS with the NASA Infrared Telescope Facility , arXiv e-prints, arXiv:2507.12234. 2507.12234

    2025 arXiv

  49. [57]

    2020, title Coma Anisotropy and the Rotation Pole of Interstellar Comet 2I/Borisov , , 895, L34, 10.3847/2041-8213/ab9228

    Kim , Y., Jewitt , D., Mutchler , M., et al. 2020, title Coma Anisotropy and the Rotation Pole of Interstellar Comet 2I/Borisov , , 895, L34, 10.3847/2041-8213/ab9228

    2020 doi

  50. [58]

    M., Protopapa , S., Kelley , M

    Knight , M. M., Protopapa , S., Kelley , M. S. P., et al. 2017, title On the Rotation Period and Shape of the Hyperbolic Asteroid 1I/ Oumuamua (2017 U1) from Its Lightcurve , ApJL, 851, L31, 10.3847/2041-8213/aa9d81

    2017 doi

  51. [59]

    Kolokolova , L., Kelley , M. S. P., Kimura , H., & Hoang , T. 2024, in Comets III, ed. K. J. Meech , M. R. Combi , D. Bockel \'e e-Morvan , S. N. Raymodn , & M. E. Zolensky ( University of Arizona Press ), 621--652

    2024

  52. [60]

    2004, in Society of Photo-Optical Instrumentation Engineers (SPIE) Conference Series, Vol

    Lantz , B., Aldering , G., Antilogus , P., et al. 2004, in Society of Photo-Optical Instrumentation Engineers (SPIE) Conference Series, Vol. 5249, Optical Design and Engineering, ed. L. Mazuray , P. J. Rogers , & R. Wartmann , 146--155, 10.1117/12.512493

    2004 doi

  53. [61]

    G., Cabot , S

    Levine , W. G., Cabot , S. H. C., Seligman , D., & Laughlin , G. 2021, title Constraints on the Occurrence of 'Oumuamua-Like Objects , , 922, 39, 10.3847/1538-4357/ac1fe6

    2021 doi

  54. [62]

    G., & Laughlin , G

    Levine , W. G., & Laughlin , G. 2021, title Assessing the Formation of Solid Hydrogen Objects in Starless Molecular Cloud Cores , , 912, 3, 10.3847/1538-4357/abec85

    2021 doi

  55. [63]

    W., Lee , C.-H., Gerdes , D

    Lin , H. W., Lee , C.-H., Gerdes , D. W., et al. 2020, title Detection of Diatomic Carbon in 2I/Borisov , , 889, L30, 10.3847/2041-8213/ab6bd9

    2020 doi

  56. [64]

    Lister , T., Kelley , M. S. P., Holt , C. E., et al. 2022, title The LCO Outbursting Objects Key Project: Overview and Year 1 Status , , 3, 173, 10.3847/PSJ/ac7a31

    2022 doi

  57. [65]

    Discovery and Preliminary Characterization of a Third Interstellar Object: 3I/ATLAS

    Loeb, A. 2025, title Comment on "Discovery and Preliminary Characterization of a Third Interstellar Object: 3I/ATLAS" [arXiv:2507.02757], 2507.05881

    2025 arXiv

  58. [66]

    X., Flekk y , E

    Luu , J. X., Flekk y , E. G., & Toussaint , R. 2020, title 'Oumuamua as a Cometary Fractal Aggregate: The ``Dust Bunny'' Model , , 900, L22, 10.3847/2041-8213/abafa7

    2020 doi

  59. [67]

    2017, title Kinematics of the Interstellar Vagabond 1I/Oumuamua (A/2017 U1) , Research Notes of the American Astronomical Society, 1, 21, 10.3847/2515-5172/aa9bdc

    Mamajek , E. 2017, title Kinematics of the Interstellar Vagabond 1I/Oumuamua (A/2017 U1) , Research Notes of the American Astronomical Society, 1, 21, 10.3847/2515-5172/aa9bdc

    2017 doi

  60. [68]

    2019, title Modelling the light curve of `Oumuamua: evidence for torque and disc-like shape , MNRAS, 489, 3003, 10.1093/mnras/stz2380

    Mashchenko , S. 2019, title Modelling the light curve of `Oumuamua: evidence for torque and disc-like shape , MNRAS, 489, 3003, 10.1093/mnras/stz2380

    2019 doi

  61. [69]

    J., Cochran , A

    McKay , A. J., Cochran , A. L., Dello Russo , N., & DiSanti , M. A. 2020, title Detection of a Water Tracer in Interstellar Comet 2I/Borisov , , 889, L10, 10.3847/2041-8213/ab64ed

    2020 doi

  62. [70]

    J., Weryk , R., Micheli , M., et al

    Meech , K. J., Weryk , R., Micheli , M., et al. 2017, title A brief visit from a red and extremely elongated interstellar asteroid , Nature, 552, 378, 10.1038/nature25020

    2017 doi

  63. [71]

    J., et al

    Micheli , M., Farnocchia , D., Meech , K. J., et al. 2018, title Non-gravitational acceleration in the trajectory of 1I/2017 U1 ('Oumuamua) , , 559, 223, 10.1038/s41586-018-0254-4

    2018 doi

  64. [72]

    2017, title PHOTOMETRYPIPELINE: An automated pipeline for calibrated photometry, Astronomy and Computing, 18, 47

    Mommert, M. 2017, title PHOTOMETRYPIPELINE: An automated pipeline for calibrated photometry, Astronomy and Computing, 18, 47

    2017

  65. [73]

    2019, title Could 1I/’Oumuamua be an Icy Fractal Aggregate? , 872, L32

    Moro-Mart \' n, A. 2019, title Could 1I/’Oumuamua be an Icy Fractal Aggregate? , 872, L32

    2019

  66. [74]

    2022, title Interstellar planetesimals , arXiv e-prints, arXiv:2205.04277, 10.48550/arXiv.2205.04277

    Moro-Mart \' n , A. 2022, title Interstellar planetesimals , arXiv e-prints, arXiv:2205.04277, 10.48550/arXiv.2205.04277

    2022 doi arXiv

  67. [75]

    2019, title 2I/Borisov: A C _ 2 -depleted interstellar comet , , 631, L8, 10.1051/0004-6361/201936959

    Opitom , C., Fitzsimmons , A., Jehin , E., et al. 2019, title 2I/Borisov: A C _ 2 -depleted interstellar comet , , 631, L8, 10.1051/0004-6361/201936959

    2019 doi

  68. [76]

    2025, title Initial VLT/MUSE spectroscopy of the interstellar object 3I/ATLAS, 2507.05226

    Opitom, C., Snodgrass, C., Jehin, E., et al. 2025, title Initial VLT/MUSE spectroscopy of the interstellar object 3I/ATLAS, 2507.05226

    2025 arXiv

  69. [77]

    Protopapa , S., Kelley , M. S. P., Yang , B., et al. 2018, title Icy Grains from the Nucleus of Comet C/2013 US _ 10 (Catalina) , , 862, L16, 10.3847/2041-8213/aad33b

    2018 doi

  70. [78]

    2019, title Outgassing As Trigger of 1I/`Oumuamua's Nongravitational Acceleration: Could This Hypothesis Work at All? , arXiv e-prints, arXiv:1905.00935

    Sekanina , Z. 2019, title Outgassing As Trigger of 1I/`Oumuamua's Nongravitational Acceleration: Could This Hypothesis Work at All? , arXiv e-prints, arXiv:1905.00935. 1905.00935

    2019 arXiv

  71. [79]

    2020, title Evidence that 1I/2017 U1 ('Oumuamua) was Composed of Molecular Hydrogen Ice , , 896, L8, 10.3847/2041-8213/ab963f

    Seligman , D., & Laughlin , G. 2020, title Evidence that 1I/2017 U1 ('Oumuamua) was Composed of Molecular Hydrogen Ice , , 896, L8, 10.3847/2041-8213/ab963f

    2020 doi

  72. [80]

    Z., & Moro-Mart \' n , A

    Seligman , D. Z., & Moro-Mart \' n , A. 2023, title Interstellar objects , Contemporary Physics, 63, 200, 10.1080/00107514.2023.2203976

    2023

  73. [81]

    Z., Farnocchia , D., Micheli , M., et al

    Seligman , D. Z., Farnocchia , D., Micheli , M., et al. 2023, title Dark Comets? Unexpectedly Large Nongravitational Accelerations on a Sample of Small Asteroids , , 4, 35, 10.3847/PSJ/acb697

    2023 doi

  74. [82]

    Z., Farnocchia , D., Micheli , M., et al

    Seligman , D. Z., Farnocchia , D., Micheli , M., et al. 2024, title Two distinct populations of dark comets delineated by orbits and sizes , Proceedings of the National Academy of Science, 121, e2406424121, 10.1073/pnas.2406424121

    2024 doi

  75. [83]

    W., Smartt , S

    Smith , K. W., Smartt , S. J., Young , D. R., et al. 2020, title Design and Operation of the ATLAS Transient Science Server , , 132, 085002, 10.1088/1538-3873/ab936e

    2020 doi

  76. [84]

    G., & Seligman , D

    Taylor , A. G., & Seligman , D. Z. 2025, title The Kinematic Age of 3I/ATLAS and its Implications for Early Planet Formation , arXiv e-prints, arXiv:2507.08111. 2507.08111

    2025 arXiv

  77. [85]

    G., Seligman , D

    Taylor , A. G., Seligman , D. Z., Hainaut , O. R., & Meech , K. J. 2023, title Fitting the Light Curve of 1I/'Oumuamua with a Nonprincipal Axis Rotational Model and Outgassing Torques , , 4, 186, 10.3847/PSJ/acf617

    2023 doi

  78. [86]

    G., Steckloff , J

    Taylor , A. G., Steckloff , J. K., Seligman , D. Z., et al. 2024, title The dynamical origins of the dark comets and a proposed evolutionary track , , 420, 116207, 10.1016/j.icarus.2024.116207

    2024

  79. [87]

    L., Denneau , L., Heinze , A

    Tonry , J. L., Denneau , L., Heinze , A. N., et al. 2018 a , title ATLAS: A High-cadence All-sky Survey System , , 130, 064505, 10.1088/1538-3873/aabadf

    2018 doi

  80. [88]

    L., Denneau , L., Flewelling , H., et al

    Tonry , J. L., Denneau , L., Flewelling , H., et al. 2018 b , title The ATLAS All-Sky Stellar Reference Catalog , , 867, 105, 10.3847/1538-4357/aae386

    2018 doi

  81. [89]

    E., Mommert, M., Hora, J

    Trilling, D. E., Mommert, M., Hora, J. L., et al. 2018, title Spitzer observations of interstellar object 1I/‘Oumuamua, , 156, 261

    2018

  82. [90]

    A., Shappee , B

    Tucker , M. A., Shappee , B. J., Huber , M. E., et al. 2022, title The Spectroscopic Classification of Astronomical Transients (SCAT) Survey: Overview, Pipeline Description, Initial Results, and Future Plans , , 134, 124502, 10.1088/1538-3873/aca719

    2022 doi

  83. [91]

    V., Sato , H., Sarneczky , K., et al

    Williams , G. V., Sato , H., Sarneczky , K., et al. 2017, title Minor Planets 2017 SN\_33 and 2017 U1 , Central Bureau Electronic Telegrams, 4450, 1

    2017

  84. [92]

    Xing , Z., Bodewits , D., Noonan , J., & Bannister , M. T. 2020, title Water Production Rates and Activity of Interstellar Comet 2I/Borisov , , 893, L48, 10.3847/2041-8213/ab86be

    2020 doi

  85. [93]

    Z., et al

    Yaginuma , A., Frincke , T., Seligman , D. Z., et al. 2025, title The Feasibility of a Spacecraft Flyby with the Third Interstellar Object 3I/ATLAS from Earth or Mars , arXiv e-prints, arXiv:2507.15755. 2507.15755

    2025

  86. [94]

    J., Connelley , M., & Keane , J

    Yang , B., Meech , K. J., Connelley , M., & Keane , J. V. 2025, title Spectroscopic Characterization of Interstellar Object 3I/ATLAS: Water Ice in the Coma , arXiv e-prints, arXiv:2507.14916. 2507.14916

    2025

  87. [95]

    A., et al

    Yang, B., Li, A., Cordiner, M. A., et al. 2021, title Compact pebbles and the evolution of volatiles in the interstellar comet 2I/Borisov, Nature Astronomy, 10.1038/s41550-021-01336-w

    2021 doi

  88. [97]

    Ye , Q., Kelley , M. S. P., Bolin , B. T., et al. 2020 b , title Pre-discovery Activity of New Interstellar Comet 2I/Borisov beyond 5 au , , 159, 77, 10.3847/1538-3881/ab659b

    2020 doi

  89. [98]

    Ye , Q.-Z., Zhang , Q., Kelley , M. S. P., & Brown , P. G. 2017, title 1I/2017 U1 (`Oumuamua) is Hot: Imaging, Spectroscopy, and Search of Meteor Activity , , 851, L5, 10.3847/2041-8213/aa9a34

    2017 doi

Pith tools

Reviewed August 6, 2026 · model on record in the stance chip above.