pith. sign in

arxiv: 1806.02389 · v2 · pith:WNNSJ6LInew · submitted 2018-06-06 · 📊 stat.ML · cs.LG

Not All Attributes are Created Equal: d_{mathcal{X}}-Private Mechanisms for Linear Queries

classification 📊 stat.ML cs.LG
keywords privacydatamathcalprivatelinearqueriesattributesprocedure
0
0 comments X
read the original abstract

Differential privacy provides strong privacy guarantees simultaneously enabling useful insights from sensitive datasets. However, it provides the same level of protection for all elements (individuals and attributes) in the data. There are practical scenarios where some data attributes need more/less protection than others. In this paper, we consider $d_{\mathcal{X}}$-privacy, an instantiation of the privacy notion introduced in \cite{chatzikokolakis2013broadening}, which allows this flexibility by specifying a separate privacy budget for each pair of elements in the data domain. We describe a systematic procedure to tailor any existing differentially private mechanism that assumes a query set and a sensitivity vector as input into its $d_{\mathcal{X}}$-private variant, specifically focusing on linear queries. Our proposed meta procedure has broad applications as linear queries form the basis of a range of data analysis and machine learning algorithms, and the ability to define a more flexible privacy budget across the data domain results in improved privacy/utility tradeoff in these applications. We propose several $d_{\mathcal{X}}$-private mechanisms, and provide theoretical guarantees on the trade-off between utility and privacy. We also experimentally demonstrate the effectiveness of our procedure, by evaluating our proposed $d_{\mathcal{X}}$-private Laplace mechanism on both synthetic and real datasets using a set of randomly generated linear queries.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Context-aware Privacy Bounds for Linear Queries

    cs.IT 2026-01 conditional novelty 6.0

    A tight context-aware leakage bound for general linear queries is derived under a prior probability lower bound, proven strictly tighter than differential privacy and converging to it as the bound approaches zero.