pith. sign in

arxiv: hep-ph/9709449 · v2 · submitted 1997-09-24 · ✦ hep-ph

Effective theories for real-time correlations in hot plasmas

classification ✦ hep-ph
keywords theorycasecorrelationcorrelationseffectivekineticneededplasmas
0
0 comments X
read the original abstract

We discuss the sequence of effective theories needed to understand the qualitative, and quantitative, behavior of real-time correlators < A(t) A(0) > in ultra-relativistic plasmas. We analyze in detail the case where A is a gauge-invariant conserved current. This case is of interest because it includes a correlation recently measured in lattice simulations of classical, hot, SU(2)-Higgs gauge theory. We find that simple perturbation theory, free kinetic theory, linearized kinetic theory, and hydrodynamics are all needed to understand the correlation for different ranges of time. We emphasize how correlations generically have power-law decays at very large times due to non-linear couplings to long-lived hydrodynamic modes.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Late-Time Relaxation from Landau Singularities

    hep-th 2026-05 unverdicted novelty 7.0

    Landau singularity analysis of two-point functions in Schwinger-Keldysh EFTs identifies nonlinear relaxation modes that produce power-law late-time decay when gapless modes are present.