Mean-field dynamics of sequence processing neural networks with finite connectivity
classification
❄️ cond-mat.dis-nn
cond-mat.stat-mechmath-phmath.MPq-bio.NC
keywords
connectivityfinitedynamicsmean-fieldnetworknetworksneuralprocessing
read the original abstract
A recent dynamic mean-field theory for sequence processing in fully connected neural networks of Hopfield-type (During, Coolen and Sherrington, 1998) is extended and analized here for a symmetrically diluted network with finite connectivity near saturation. Equations for the dynamics and the stationary states are obtained for the macroscopic observables and the precise equivalence is established with the single-pattern retrieval problem in a layered feed-forward network with finite connectivity.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.