Pith. sign in

REVIEW 4 cited by

Does CLIP Benefit Visual Question Answering in the Medical Domain as Much as it Does in the General Domain?

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2112.13906 v1 pith:LB3S2DVN submitted 2021-12-27 cs.CV cs.AIcs.CLcs.LG

classification cs.CVcs.AIcs.CLcs.LG
keywords pubmedclipvisualclipmedvqamedicalansweringdatasetsdomain
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Contrastive Language--Image Pre-training (CLIP) has shown remarkable success in learning with cross-modal supervision from extensive amounts of image--text pairs collected online. Thus far, the effectiveness of CLIP has been investigated primarily in general-domain multimodal problems. This work evaluates the effectiveness of CLIP for the task of Medical Visual Question Answering (MedVQA). To this end, we present PubMedCLIP, a fine-tuned version of CLIP for the medical domain based on PubMed articles. Our experiments are conducted on two MedVQA benchmark datasets and investigate two MedVQA methods, MEVF (Mixture of Enhanced Visual Features) and QCR (Question answering via Conditional Reasoning). For each of these, we assess the merits of visual representation learning using PubMedCLIP, the original CLIP, and state-of-the-art MAML (Model-Agnostic Meta-Learning) networks pre-trained only on visual data. We open source the code for our MedVQA pipeline and pre-training PubMedCLIP. CLIP and PubMedCLIP achieve improvements in comparison to MAML's visual encoder. PubMedCLIP achieves the best results with gains in the overall accuracy of up to 3%. Individual examples illustrate the strengths of PubMedCLIP in comparison to the previously widely used MAML networks. Visual representation learning with language supervision in PubMedCLIP leads to noticeable improvements for MedVQA. Our experiments reveal distributional differences in the two MedVQA benchmark datasets that have not been imparted in previous work and cause different back-end visual encoders in PubMedCLIP to exhibit different behavior on these datasets. Moreover, we witness fundamental performance differences of VQA in general versus medical domains.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 4 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. LangMamba: A Language-driven Mamba Framework for Low-dose CT Denoising with Vision-language Models

    eess.IV 2025-07 conditional novelty 6.0 of 10

    A language-driven Mamba framework for low-dose CT denoising uses a frozen vision-language model to provide semantic supervision, achieving marginal but consistent quantitative gains over previous methods.

  2. InverTune: Removing Backdoors from Multimodal Contrastive Learning Models via Trigger Inversion and Activation Tuning

    cs.CR 2025-06 conditional novelty 6.0 of 10

    InverTune removes backdoors from CLIP models by identifying the target label via adversarial perturbations, inverting the trigger, and selectively tuning backdoor-sensitive neurons, reducing attack success rates to ne...

  3. VSF-Med:A Vulnerability Scoring Framework for Medical Vision-Language Models

    cs.CV 2025-06 reject novelty 5.0 of 10

    VSF-Med introduces an eight-dimension, judge-scored vulnerability score for medical VLMs and reports that all five tested models are most vulnerable to persistent attack effects, with Llama-3.2 showing the largest drop.

  4. Prompt Mechanisms in Medical Imaging: A Comprehensive Survey

    eess.IV 2025-06 conditional novelty 4.0 of 10

    A broad survey that organizes prompt mechanisms for medical image generation, segmentation, and classification into a two-dimensional taxonomy of core technologies and clinical applications.

Pith tools