Pith. sign in

REVIEW 17 cited by

An approach to computing spectral shifts for black holes beyond Kerr

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2206.10653 v1 pith:27EMOJSU submitted 2022-06-21 gr-qc

An approach to computing spectral shifts for black holes beyond Kerr

classification gr-qc
keywords blackholesringdownapproachrelativityshiftskerrspectral
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
read the original abstract

Recent measurements of gravitational-wave ringdown following the merger of binary black holes raise the prospect of precision black hole spectroscopy in the near future. To perform the most sensitive tests of the nature of black holes using ringdown measurements, it is critical to compute the deviations to the spectrum of black holes in particular extensions of relativity. These spectral shifts are also needed to interpret any violations of the predictions of relativity that may be detected during ringdown. Here we present a first step towards computing the shifts to the spectrum of Kerr black holes with arbitrary spins, by deriving a modified Teukolsky equation governing the perturbations of black holes in theories beyond GR. Our approach applies to a class of theories which includes dynamical Chern-Simons gravity and shift-symmetric scalar Gauss-Bonnet gravity, in the case where the deviations from relativity are small. This allows for a perturbative approach to solving the equations of motion. Further, we show how to use the modified equation to compute the leading-order spectral shifts of Kerr black holes, using eigenvalue perturbation methods. Our formalism provides a practical approach to predicting ringdown for black holes in a range of promising extensions to relativity, enabling future precision searches for their signatures in black hole ringdown.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 17 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Schr\"odinger perturbation theory for black hole quasinormal modes

    gr-qc 2026-07 conditional novelty 7.0

    A bilinear-form framework computes black-hole quasinormal-mode frequency shifts to any order, but the mode-sum expansion of the first-order mode shift diverges and needs a continuum piece.

  2. Modified Teukolsky Formalism for Extreme Mass-Ratio Inspirals in Higher-Derivative Gravity

    gr-qc 2026-06 unverdicted novelty 7.0

    Develops modified Teukolsky formalism for EMRIs in higher-derivative gravity and computes horizon and infinity fluxes for cubic gravity example.

  3. Metric Reconstruction for Generic Black-Hole Perturbations

    gr-qc 2026-05 unverdicted novelty 7.0

    A traceful radiation gauge plus two transport equations from the stress-energy tensor enable hierarchical metric reconstruction for generic sources in Petrov type D black hole spacetimes.

  4. Beyond Three Terms: Continued Fractions for Rotating Black Holes in Modified Gravity

    gr-qc 2026-04 unverdicted novelty 7.0

    A reduction scheme transforms arbitrary N-term scalar and matrix recurrence relations from black hole perturbations in modified gravity into three-term relations solvable by continued fractions.

  5. Quadratic gravity corrections to scalar QNMs of rapidly rotating black holes

    gr-qc 2026-04 unverdicted novelty 7.0

    Leading-order deviations from general relativity in scalar quasinormal modes of rotating black holes are computed numerically up to dimensionless spins of 0.99 in quadratic-curvature scalar-tensor theories.

  6. Black hole mergers beyond general relativity: a self-force approach

    gr-qc 2025-10 unverdicted novelty 7.0

    Self-force theory is extended to compute merger and ringdown waveforms in beyond-GR black hole binaries under the extreme mass-ratio approximation, with first calculations of self-force corrections to the merger waveform.

  7. Parametrized beyond-Teukolsky framework in the time domain

    gr-qc 2026-07 conditional novelty 6.0

    First time-domain implementation of the parametrized beyond-Teukolsky framework, validated against frequency-domain benchmarks for low multipoles and yielding new amplitude, phase, quadratic-coefficient, and tail-onse...

  8. Bilinear products and the orthogonality of quasinormal modes on hyperboloidal foliations

    gr-qc 2026-04 unverdicted novelty 6.0

    Bilinear products for black hole quasinormal modes on hyperboloidal foliations are divergent due to CPT transformations but can be regularized to define orthogonal modes and excitation coefficients.

  9. Ringing of rapidly rotating black holes in effective field theory

    gr-qc 2026-04 unverdicted novelty 6.0

    Leading-order cubic-curvature corrections to scalar quasinormal modes of black holes with spins up to 0.99M are computed numerically for modes up to l=5 with relative errors below 10^{-4}.

  10. Discrete symmetries of modified Teukolsky equations

    gr-qc 2026-07 conditional novelty 5.0

    Complex modifications of the Teukolsky potential break m=0 QNM degeneracy and can inject non-physical mode branches when frequency-domain multipole-dependent potentials are evolved in time.

  11. Constraining deviations from the Teukolsky equation with GW250114

    gr-qc 2026-07 conditional novelty 5.0

    GW250114's fundamental ringdown mode bounds theory-agnostic deviations from the Teukolsky equation to be consistent with zero at characteristic scales of 60-100 km.

  12. Confronting eikonal and post-Kerr methods with numerical evolution of scalar field perturbations in spacetimes beyond Kerr

    gr-qc 2026-01 unverdicted novelty 5.0

    Numerical simulations benchmark the eikonal and post-Kerr approximations for quasinormal modes in deformed Kerr spacetimes, quantifying their errors relative to expected observational precision.

  13. Dynamical Tidal Response of Non-rotating Black Holes: Connecting the MST Formalism and Worldline EFT

    gr-qc 2025-11 unverdicted novelty 5.0

    Renormalized dynamical tidal response functions for non-rotating black holes in GR carry inevitable ambiguities from renormalization scheme and flow initial condition, yielding scheme-dependent dynamical tidal Love nu...

  14. GW250114: testing Hawking's area law and the Kerr nature of black holes

    gr-qc 2025-09 accept novelty 5.0

    GW250114 data confirm the remnant black hole ringdown frequencies lie within 30% of Kerr predictions and that the final horizon area is larger than the sum of the progenitors' areas to high credibility.

  15. A multi-parameter expansion for the evolution of asymmetric binaries in astrophysical environments

    gr-qc 2025-07 unverdicted novelty 5.0

    A multi-parameter formalism is developed to describe asymmetric binaries in general matter distributions by perturbing around Schwarzschild and reducing metric and fluid perturbations to wave equations similar to the ...

  16. When Black Holes Can Wear Pants

    gr-qc 2026-06 unverdicted novelty 3.0

    Theoretical investigation of black hole fragmentation possibilities beyond standard GR constraints, with relevance to primordial black holes and mergers.

  17. Black hole spectroscopy: from theory to experiment

    gr-qc 2025-05 unverdicted novelty 2.0

    A review summarizing the state of the art in black hole quasinormal modes, ringdown waveform modeling, current LIGO-Virgo-KAGRA observations, and prospects for LISA and next-generation detectors.