Pith. sign in

REVIEW 3 major objections 4 minor 3 cited by

Revisiting the Classics: On the Statistics of Dust Formation in Novae

T0 review · 3 major / 4 minor · reviewed 2026-08-10 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read About 50 to 70 percent of novae form dust, making dust formation the rule rather than the exception among nova eruptions.

desk verdict A genuinely useful re-measurement of the nova dust fraction; the 50-70% number is plausible but sample representativeness and manual classification keep it from being definitive. read the letter →

arxiv 2501.04098 v1 pith:WQKKCDIZ submitted 2025-01-07 astro-ph.HE astro-ph.GAastro-ph.SR

Atticus Chong , Elias Aydi , Peter Craig , Laura Chomiuk , Ashley Stone , Jay Strader , Adam Kawash , Kirill V. Sokolovsky
show 1 more author
Fred Walter
This is my paper · ORCID
classification astro-ph.HEastro-ph.GAastro-ph.SR
keywords novaedustformationinfraredphotometry(V-K)colourdiagnostictime-domainsurveysgamma-raywhitedwarfsclassical
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

Across 40 well-sampled novae, the paper finds that between 50 and 70 percent form dust, at least $53\pm8$ percent and at most $70^{+6}_{-8}$ percent, which is roughly three times the share inferred from optical-only light curves in earlier work. It argues that dust formation is therefore the normal outcome of a nova eruption, not a rare one. The paper also proposes that a single number, the largest redward shift in the $(V-K)$ colour from peak with a cutoff near 2.35 mag, separates dust-forming from non-dust-forming novae in optical plus infrared photometry. If the estimate holds, nova dust is common enough to make novae a primary local laboratory for how explosive transients make dust.

What carries the argument

The load-bearing tool is the largest redward excursion of the $(V-K)$ colour measured relative to the colour at $V$-band peak, with a separation cut at $\Delta(V-K)>2.35$ mag. Dust absorbs optical light and re-emits it in the infrared, so a large redward swing isolates dust formation while remaining insensitive to interstellar reddening. The paper combines this colour diagnostic with a manual classification of each nova as a 'Dust Dip', 'IR Excess', 'None', or 'Unsure', and shows that the $(V-K)$ cutoff cleanly separates the dust-forming groups from the others, apart from novae with red-giant companions whose intrinsic reddening mimics dust. The $(V-J)$ and $(V-H)$ colour changes work in the same direction but with more false positives, because the thermal re-emission of typical nova dust peaks inside the $K$ band.

What would settle it

Conduct a red or near-infrared selected survey of novae in the Galactic plane, count how many show a redward $(V-K)$ excursion greater than 2.35 mag from peak, and compare that fraction with 50–70 percent; a fraction well below 50 percent would show that optical discovery bias inflated the central estimate.

Watch

Extended reading notes

Core claim

The paper's central claim is that 50–70 percent of classical novae form dust: at least 53 percent of the 40-nova sample show dust signatures in their optical and near-infrared light curves, and even under the most conservative accounting of the uncertain cases the fraction would not exceed $70^{+6}_{-8}$ percent. The authors reach this by inspecting $V$- and $K$-band light curves and classifying each nova as a clear 'Dust Dip' (dust optically thick along the line of sight), an 'IR Excess' (dust present but optically thin), 'None', or 'Unsure'. They find that very fast novae with $t_2<10$ days seldom form dust, while about 70 percent of novae with $t_2$ between 11 and 80 days do, and that novae detected in GeV gamma rays form dust more often (about 86 percent) than those not detected (about 38 percent), part of a pattern expected if dust condenses in radiative shocks. They also argue that the long-noticed correlation between $t_2$ and the onset time of dust formation is largely a measurement artifact: for roughly a third of novae the two-magnitude decline that defines $t_2$ is caused by the dust dip itself.

Load-bearing premise

The 40 novae with dense optical and infrared coverage represent all classical novae, even though the monitoring program intentionally favored fast, recurrent, and LMC systems and optical surveys systematically miss heavily extinguished fast novae near the Galactic plane.

Editorial extensions

If this is right

  • Dust formation should be treated as the norm in nova populations, so estimates of how much dust novae return to the interstellar medium should be revised upward.
  • Optical-only light curves miss roughly one in seven dust-forming novae that show an IR excess without a deep optical dip, so multi-band optical plus infrared photometry is needed for demographics.
  • A $(V-K)$ reddening of more than 2.35 mag from peak is a practical, extinction-tolerant diagnostic that upcoming red and infrared time-domain surveys can apply even when the exact peak is missed.
  • Very fast novae with $t_2\le10$ days mostly avoid dust, while the majority of novae with $t_2=11$--$80$ days form dust, strengthening the old speed-class trend with direct infrared data.
  • Using $t_2$ as a proxy for ejecta velocity is unreliable for dust-forming novae, because the dust dip itself can determine when the light curve drops two magnitudes below peak.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • If a hidden population of heavily extinguished fast thin-disk novae exists, the true Galactic dust fraction could sit near or below the paper's lower bound, while short subtle dust events like V745 Sco could be missed entirely, so the two selection effects pull in opposite directions.
  • The paper's J/H cutoffs imply that single-band infrared surveys without simultaneous optical data will incur a measurable false-positive rate when flagging dust formation; calibrating that rate requires a blind multi-band sample.
  • The gamma-ray/dust correlation strengthens the radiative-shock picture only if it survives correction for distance and optical brightness, since gamma-ray detected novae in this sample are systematically bright and nearby.
  • A volume-complete census of dust formation in Magellanic Cloud novae, where extinction is manageable, would test the representativeness assumption without waiting for a full Galactic-plane infrared survey.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 4 minor

Summary. This paper uses 40 well-sampled SMARTS novae with optical and near-IR light curves to estimate the fraction of novae that form dust. The authors manually classify each nova as Dust Dip, IR Excess, None, or Unsure, propose a largest-redward-(V-K)-color-change diagnostic with a threshold of 2.35 mag, and find that 50-70% of the sample form dust. They further report that very fast novae (t2<10 days) rarely form dust, that Fermi-LAT-detected novae are more likely to be dust-forming, and that the long-noted t2-versus-dust-onset correlation is largely an artifact of dust formation itself causing the two-magnitude decline.

Significance. If the 50-70% fraction applies to the broader Galactic nova population, it is a substantial upward revision from earlier estimates near 20% and would establish dust formation as the norm rather than the exception, with direct implications for shock-mediated dust formation models. The paper's strengths include a public dataset, a transparent treatment of the 'Unsure' category, and appropriate use of binomial confidence intervals. However, the population-level claim currently rests on sample representativeness and on subjective manual classifications, so the headline statistic should be treated as provisional until these are addressed.

major comments (3)
  1. [Section 4.2 and Figure 11] The central claim that 50-70% of novae form dust assumes that the 40 selected SMARTS novae represent the broader discovered, or ideally intrinsic, Galactic nova population. The comparison with the Craig et al. sample cannot validate this assumption because that comparison sample is itself optically selected. The manuscript itself concedes that heavily extinguished thin-disk novae, potentially fast and non-dust-forming, are systematically missed by optical surveys. Since Figure 11 shows only about 17% of very fast novae form dust, a plausible hidden population of fast, extinguished novae would push the fraction below 50%. Please either provide a quantitative selection-bias analysis using independent constraints (e.g., IR surveys) or restrict the headline claim and the abstract wording to the studied sample and to the currently discovered population.
  2. [Section 2.2 and Table 1] The dust classifications that drive the 53-70% estimate are assigned manually from inspection, with qualitative category definitions and no inter-rater reliability or blinding described. Some classifications also depend on external literature rather than the uniform V/K criteria: RS Oph is placed in 'None' from IR spectroscopy arguments, while V745 Sco is placed in 'IR Excess' primarily from CO detections. Because the lower bound is exactly 21/40, a small number of label changes would alter the headline fraction. Please report a sensitivity analysis (e.g., moving V745 Sco to 'None', or RS Oph to a dust-forming class) and, ideally, an independent blind reclassification by multiple raters.
  3. [Section 3.1 and Figure 8] The 2.35 mag (V-K) threshold is presented as a diagnostic that 'does a good job separating' dust-forming from non-dust-forming novae, but the threshold is drawn through the same points that were manually classified from the same light curves. It is therefore an in-sample descriptive separator, not an independent validation of the classification. The paper should state this explicitly, and the diagnostic should be tested on an independent sample or applied with pre-registered criteria before it is recommended for future surveys.
minor comments (4)
  1. [Figures 9 and 10 captions] The captions refer to a '(V-K) colour change' of 1.8 and 1.0, but these figures plot (V-H) and (V-J); the band labels should be corrected.
  2. [Section 2.2 and Table 1] The text says that 21 novae show dust signatures 'including PR Lup and V5668 Sgr', but Table 1 classifies V5668 Sgr as 'Dust Dip' rather than uncertain; this is likely meant to be V5584 Sgr. The same inconsistency appears in Section 4.2, where the eight 'IR excess' novae include PR Lup and V5584 Sgr, even though Table 1 labels them 'Dust/Unsure'.
  3. [Abstract and Section 5] The abstract and conclusion state '50-70% of novae form dust' without the qualifiers used in Section 4.2, which limits the statement to the sample and to currently discovered novae. The wording should be aligned throughout.
  4. [Appendix C] The intrinsic (V-K)0 peak color has a large scatter of 0.8 mag based on 9 novae, so the resulting 'likely dust' threshold of (V-K)0 > 5.1 has considerable uncertainty; this should be stated wherever the threshold is offered for cases with no peak photometry.

Circularity Check

1 steps flagged · score 3.0 of 10

The central dust-fraction count is largely independent, but the proposed V-K diagnostic threshold is an in-sample fit to the same light curves used for classification.

  1. fitted input called prediction [Section 3.1 (V-K colour diagnostic); cf. Section 2.2 categories]
    "Our best single diagnostic for dust formation in novae is an observation of (V − K) colour that is> 2.35 mag redder than at peak."

    Dust classifications ('Dust Dip', 'IR Excess') are assigned from V and K light curves (Section 2.2). The diagnostic is the largest redward (V-K) change, a combination of those same bands, and the cutoff is chosen after the fact in Figure 8 to separate the hand-made labels. Hence the threshold quantifies the classification rather than independently verifying it. Also, V5584 Sgr and PR Lup are called dust-formers mainly from the (V-K) color change, so the lower bound partially depends on that same observable.

full rationale

The paper's central claim, that 50-70% of the sampled novae form dust, is a direct count of manually classified V/K light curves and does not depend on the 2.35 mag diagnostic; removing the threshold would not change the count of 21 dust-forming novae. The classification criteria (dust dip, IR excess, none, unsure) are stated independently of the colour-cutoff, and the paper is transparent about uncertain cases and about the selection bias of optically discovered novae. The V-K diagnostic itself is a real empirical summary, but because the cutoff is chosen on the same 40 objects whose labels were derived from the same photometry, its claimed separating power is partly in-sample and not an out-of-sample prediction. The use of co-authored works (Craig et al. in preparation for t2 values and speed-class comparison; Kawash et al. for ASAS-SN) is load-bearing for the population-generalization argument, but it is not a definitional reduction of the dust-forming claim. The reinterpretation of the t2-dust-onset correlation as an artifact is an interpretation, not a circular derivation. Overall, the headline fraction has independent content, so the circularity is partial and confined mainly to the diagnostic being a fitted summary of the classification rather than independent confirmation.

Assumptions & free parameters 4 free parameters · 4 assumptions · 0 invented entities

The paper's central claims rest on hand-chosen color thresholds and manual light-curve classifications, plus the assumption that the SMARTS sample represents the broader nova population. No new physical entities are postulated; the IR Excess and Dust Dip are observational categories, not new astrophysical objects.

free parameters (4)
  • V-K color-change threshold for dust formation = 2.35 mag
    Chosen by eye from Figure 8 to separate manually classified dust-forming and non-dust-forming novae; not independently validated on an external sample.
  • V-H and V-J diagnostic thresholds = 1.8 mag and 1.0 mag
    Selected from Figures 9 and 10 to approximately separate classes; the paper notes higher false positive rates for these diagnostics.
  • Intrinsic (V-K)0 color of novae at peak = 1.1 ± 0.8 mag
    Mean reddening-corrected color at peak from 9 novae (Appendix C), used to apply the diagnostic when peak photometry is missed.
  • Intrinsic (V-J)0 and (V-H)0 colors of novae at peak = 0.8 ± 0.6 and 0.7 ± 0.6 mag
    Means over 10 and 9 novae respectively (Appendix C), used for the J/H-band variants of the diagnostic.
assumptions (4)
  • domain assumption Dust events in novae start within the first 150 days and last at least 40 days (Strope et al. 2010)
    Used in Section 2.1 to justify excluding novae with >50-day gaps before day 150; if incorrect, missed dust events would bias the derived fraction.
  • domain assumption K-band brightening/plateau together with a V-band dip traces dust formation
    Defines the Dust Dip and IR Excess categories in Section 2.2; the entire sample classification relies on this photometric signature.
  • domain assumption The SMARTS Atlas sample of discovered novae represents the underlying Galactic nova population
    Used in Section 4.2 to extrapolate the 50-70% fraction to all novae; the authors discuss but cannot fully rule out biases from missed faint/fast or heavily extinguished novae.
  • standard math Standard binomial statistics with Bayesian confidence intervals (Cameron 2011)
    Used for all fraction uncertainties in Sections 4.1-4.3.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Revisiting the Classics: On the Statistics of Dust Formation in Novae." pith.science (2026). https://pith.science/paper/WQKKCDIZ

@misc{pith2026250104098,
  author       = {Pith},
  title        = {Pith review of: Revisiting the Classics: On the Statistics of Dust Formation in Novae},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/WQKKCDIZ}},
  note         = {Machine review of arXiv:2501.04098}
}
abstract

While nova eruptions produce some of the most common and dramatic dust formation episodes among astrophysical transients, the demographics of dust-forming novae remain poorly understood. Here, we present a statistical study of dust formation in 40 novae with high-quality optical/IR light curves, quantitatively distinguishing dust-forming from non-dust-forming novae while exploring the properties of the dust events. We find that 50-70% of novae produce dust, significantly higher than previous estimates. Dust-forming novae can be separated from those that do not show dust formation by using the largest redward ($V-K$) colour change from peak visible brightness; ($V-J$) or ($V-H$) offer useful but less sensitive constraints. This makes optical+IR photometry a powerful tool to quantify dust formation in novae. We find that novae detected in GeV $\gamma$-rays by \emph{Fermi}-LAT appear to form dust more often than novae not detected by \emph{Fermi}, implying a possible connection between $\gamma$-ray producing shocks and dust production. We also find that novae that evolve very quickly ($t_2 < 10$ days) are much less likely to form dust, in agreement with previous findings. We confirm a correlation between $t_2$ and the time of the onset of dust formation (which occurs $\sim$1 week--3 months after maximum light), but conclude that it is primarily an observational artifact driven by dust formation determining when a nova drops 2 mag below peak. The significant fraction of novae that form dust make them ideal laboratories in our Galactic backyard to tackle the puzzle of dust formation around explosive transients.

Figures

Figures reproduced from arXiv: 2501.04098 by the authors.

Figure 1
Figure 1. Example V , J, H, and K light curves, and corresponding colour curves of nova V357 Mus, which we classify as ‘Dust Dip’. Its V -band light curve dramatically declines and bottoms out around day 65, while the K-band light curve remains relatively constant and even increases a bit during the V -band dust dip. J- and H-bands show behaviour intermediate to that of V - and K-bands. The blue vertical bar denotes the earli… view at source ↗
Figure 2
Figure 2. Example V and K light curves, and (V − K) colour curve, of a nova that has been classified as ‘IR Excess’: V1428 Cen. Its V -band light curves shows a smooth decline while the K-band light curve increases in flux around day 20. The (V − K) colour curve shows a clear reddening over the course of this dust formation episode. As in [PITH_FULL_IMAGE:figures/full_fig_p005_2.png] view at source ↗
Figure 4
Figure 4. Example V and K light curves, and (V − K) colour curve, of a nova that has been classified as ‘Unsure’: N LMC 2009a. It has a gap in photometric coverage during which a dust formation event could have occurred. MNRAS 000, 1–?? (2025) [PITH_FULL_IMAGE:figures/full_fig_p005_4.png] view at source ↗
Figures from the paper (11 more)
Figure 5
Figure 5. Figure 5: Example V and K light curves, and V −K colour curve, of another nova that has been classified as ‘Unsure’: V5667 Sgr. It shows some change in V − K colour but has no clear features associated with the colour change in the V and K light curves that would distinguish a d…
Figure 6
Figure 6. Figure 6: V and K light curves, and (V − K) colour curve, for PR Lup. PR Lup almost certainly formed dust, but it is unclear if it should be classified as ‘IR Excess’ or ‘Dust Dip’ due to a large gap in observations around solar conjunction. 5 7 9 11 13 15 17 19 Brightness (mag)…
Figure 7
Figure 7. Figure 7: V and K light curves, and (V − K) colour curve, for V5584 Sgr. V5584 Sgr almost certainly formed dust, but it is un￾clear if it should be classified as ‘IR Excess’ or ‘Dust Dip’ due to a large gap in observations around solar conjunction. colour plots of PR Lup and V55…
Figure 8
Figure 8. Figure 8: A plot summarizing our recommended (V − K) dust formation diagnostic. On the y-axis is plotted the largest redward change in the nova’s (V − K) colour compared to its colour at SMARTS V -band light curve peak. On the x-axis is plotted the time for this colour change to…
Figure 9
Figure 9. Figure 9: A plot similar to [PITH_FULL_IMAGE:figures/full_fig_p008_9.png]
Figure 11
Figure 11. Figure 11: Bar chart comparing the fraction of novae that form dust as a function of speed class. Black bars represent novae that do not show dust formation, red bars represent novae with evi￾dence for dust formation, and blue bars represent novae that are unsure. The errors on …
Figure 12
Figure 12. Figure 12: Top 3 panels: histograms showing the number of novae as a function of t2, divided into 5-day bins. The novae with no evidence of dust formation are presented in the top panel using black bars. The dust-forming novae (including both dust dip and IR excess) are presente…
Figure 13
Figure 13. Figure 13: Left: a pie chart representing the 21 γ-ray non-detected novae in our sample, divided into non-dust forming (grey), dust forming (light red), and unsure (light blue). Right: same as left but for the 7 γ-ray detected novae in our sample. There are no ‘unsure’ novae in …
Figure 14
Figure 14. Figure 14: The time elapsed between Vpeak and the onset of dust formation plotted against t2 for the dust forming novae in our sample (V5584 Sgr and PR Lup are excluded due to gap in photo￾metric coverage during dust event, N LMC 2009b is excluded due to lack of t2 data). The bl…
Figure 15
Figure 15. Figure 15: The time elapsed between the onset of dust formation episode and the bottom of the dust event plotted against t2 for the dust-forming novae in our sample (V475 Sct, V5584 Sgr and PR Lup are excluded due to gap in photometric coverage during dust event, N LMC 2009b is …
Figure 16
Figure 16. Figure 16: The depth of the V -band dust dip (in magnitudes) plotted against the time lag between optical light curve peak and the onset of dust formation for the dust-forming novae in our sam￾ple (V475 Sct, V5584 Sgr and PR Lup are excluded due to gap in photometric coverage du…

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 3 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Transition radiation in dusty novae with non-thermal radio emission

    astro-ph.SR 2025-07 reject novelty 6.0 of 10

    Relativistic electrons crossing dust grains in dusty novae may produce hard UV/X-ray transition radiation comparable to the central remnant, influencing grain heating and ionization.

  2. Modeling the high-brightness state of the recurrent nova T CrB as an enhanced mass-transfer event

    astro-ph.SR 2025-06 conditional novelty 6.0 of 10

    T CrB's 15-year brightening is best explained by a temporary hundredfold increase in mass transfer onto a high-viscosity disk, with the pre-eruption dip caused by an inner disk edge expanding at 0.02 km/s.

  3. Interstellar dust production, destruction and effects of dust depletion in galaxies

    astro-ph.GA 2025-06 unverdicted novelty 2.0 of 10

    The paper reviews dust production, destruction and growth processes in galaxies, compiles literature data on comoving dust mass density, presents evidence for and against interstellar dust growth, and identifies the h...

Reference graph

Works this paper leans on

137 extracted references · 26 canonical work pages · cited by 3 Pith papers

  1. [1]

    , " * write output.state after.block = add.period write newline

    ENTRY address archivePrefix author booktitle chapter doi edition editor eprint howpublished institution journal key month number organization pages publisher school series title misctitle type volume year version url label extra.label sort.label short.list INTEGERS output.state before.all mid.sentence after.sentence after.block FUNCTION init.state.consts ...

  2. [2]

    write newline

    " write newline "" before.all 'output.state := FUNCTION format.url url empty "" new.block "" url * "" * if FUNCTION format.eprint eprint empty "" archivePrefix empty "" archivePrefix "arXiv" = new.block " " eprint * " " * new.block " " eprint * " " * if if if FUNCTION format.doi doi empty "" " " doi * " " * if FUNCTION format.pid doi empty eprint empty ur...

  3. [3]

    u ller , H. and Stephenson , C. A. and S \

    thebibliography [1] 20pt to REFERENCES 6pt =0pt -12pt 10pt plus 3pt =0pt =0pt =1pt plus 1pt =0pt =0pt -12pt =13pt plus 1pt =20pt =13pt plus 1pt \@M =10000 =-1.0em =0pt =0pt 0pt =0pt =1.0em @enumiv\@empty 10000 10000 `\.\@m \@noitemerr \@latex@warning Empty `thebibliography' environment \@ifnextchar \@reference \@latexerr Missing key on reference command E...

    arXiv 1901

  4. [4]

    A., et al., 2010, @doi [Science] 10.1126/science.1192537 , http://cdsads.u-strasbg.fr/abs/2010Sci...329..817A 329, 817

    Abdo A. A., et al., 2010, @doi [Science] 10.1126/science.1192537 , http://cdsads.u-strasbg.fr/abs/2010Sci...329..817A 329, 817

    doi:10.1126/science.1192537 2010

  5. [5]

    Ackermann M., et al., 2014, @doi [Science] 10.1126/science.1253947 , http://cdsads.u-strasbg.fr/abs/2014Sci...345..554A 345, 554

    doi:10.1126/science.1253947 2014

  6. [6]

    Arai A., et al., 2010, @doi [ ] 10.1093/pasj/62.4.1103 , https://ui.adsabs.harvard.edu/abs/2010PASJ...62.1103A 62, 1103

    doi:10.1093/pasj/62.4.1103 2010

  7. [7]

    M., Banerjee D

    Ashok N. M., Banerjee D. P. K., 2003, @doi [ ] 10.1051/0004-6361:20031160 , http://cdsads.u-strasbg.fr/abs/2003A

    doi:10.1051/0004-6361:20031160 2003

  8. [8]

    B., et al., 2009, @doi [ ] 10.1088/0004-637X/697/2/1071 , https://ui.adsabs.harvard.edu/abs/2009ApJ...697.1071A 697, 1071

    Atwood W. B., et al., 2009, @doi [ ] 10.1088/0004-637X/697/2/1071 , https://ui.adsabs.harvard.edu/abs/2009ApJ...697.1071A 697, 1071

    doi:10.1088/0004-637x/697/2/1071 2009

Show all 137 references
  1. [9]

    Aydi E., et al., 2019, arXiv e-prints, https://ui.adsabs.harvard.edu/abs/2019arXiv190309232A

    2019

  2. [10]

    V., Steinberg E., 2020a, @doi [Nature Astronomy] 10.1038/s41550-017-0222-1 , http://cdsads.u-strasbg.fr/abs/2017NatAs...1..697L 2, 697

    Aydi E., Chomiuk L., Sokolovsky K. V., Steinberg E., 2020a, @doi [Nature Astronomy] 10.1038/s41550-017-0222-1 , http://cdsads.u-strasbg.fr/abs/2017NatAs...1..697L 2, 697

    doi

  3. [11]

    Aydi E., et al., 2020b, @doi [ ] 10.3847/1538-4357/abc3bb , https://ui.adsabs.harvard.edu/abs/2020ApJ...905...62A 905, 62

    doi

  4. [12]

    Babul A.-N., et al., 2022, @doi [ ] 10.1093/mnras/stac1366 , https://ui.adsabs.harvard.edu/abs/2022MNRAS.515.3028B 515, 3028

    2022 doi

  5. [13]

    Banerjee D. P. K., Ashok N. M., 2012, @doi [Bulletin of the Astronomical Society of India] 10.48550/arXiv.1306.0343 , https://ui.adsabs.harvard.edu/abs/2012BASI...40..243B 40, 243

    2012 doi arXiv

  6. [14]

    Banerjee D. P. K., Srivastava M. K., Ashok N. M., Venkataraman V., 2016, @doi [ ] 10.1093/mnrasl/slv163 , https://ui.adsabs.harvard.edu/abs/2016MNRAS.455L.109B 455, L109

    2016 doi

  7. [15]

    Banerjee D. P. K., Srivastava M. K., Ashok N. M., Munari U., Hambsch F. J., Righetti G. L., Maitan A., 2018, @doi [ ] 10.1093/mnras/stx2459 , https://ui.adsabs.harvard.edu/abs/2018MNRAS.473.1895B 473, 1895

    2018 doi

  8. [16]

    Banerjee D. P. K., Evans A., Woodward C. E., Starrfield S., Su K. Y. L., Ashok N. M., Wagner R. M., 2023a, @doi [ ] 10.3847/2041-8213/acdf56 , https://ui.adsabs.harvard.edu/abs/2023ApJ...952L..26B 952, L26

    doi

  9. [17]

    Banerjee D. P. K., et al., 2023b, @doi [ ] 10.3847/2041-8213/acf0c4 , https://ui.adsabs.harvard.edu/abs/2023ApJ...954L..16B 954, L16

    doi

  10. [18]

    K., et al., 2008, @doi [ ] 10.1086/529422 , https://ui.adsabs.harvard.edu/abs/2008ApJ...677.1253B 677, 1253

    Barry R. K., et al., 2008, @doi [ ] 10.1086/529422 , https://ui.adsabs.harvard.edu/abs/2008ApJ...677.1253B 677, 1253

    2008 doi

  11. [19]

    P., Gass H., Sedlmayr E., 1990, , https://ui.adsabs.harvard.edu/abs/1990A&A...238..283B 238, 283

    Beck H., Gail H. P., Gass H., Sedlmayr E., 1990, , https://ui.adsabs.harvard.edu/abs/1990A&A...238..283B 238, 283

    1990

  12. [20]

    F., Evans A., 1982, @doi [ ] 10.1093/mnras/200.2.175 , https://ui.adsabs.harvard.edu/abs/1982MNRAS.200..175B 200, 175

    Bode M. F., Evans A., 1982, @doi [ ] 10.1093/mnras/200.2.175 , https://ui.adsabs.harvard.edu/abs/1982MNRAS.200..175B 200, 175

    1982 doi

  13. [21]

    F., Evans A., 2008, in Classical Novae, 2nd Edition

    Bode M. F., Evans A., 2008, in Classical Novae, 2nd Edition. Edited by M.F. Bode and A. Evans. Cambridge Astrophysics Series, No. 43, Cambridge: Cambridge University Press, 2008

    2008

  14. [22]

    F., Evans A., Whittet D

    Bode M. F., Evans A., Whittet D. C. B., Aitken D. K., Roche P. F., Whitmore B., 1984, @doi [ ] 10.1093/mnras/207.4.897 , https://ui.adsabs.harvard.edu/abs/1984MNRAS.207..897B 207, 897

    1984 doi

  15. [23]

    F., et al., 2016, @doi [ ] 10.3847/0004-637X/818/2/145 , http://cdsads.u-strasbg.fr/abs/2016ApJ...818..145B 818, 145

    Bode M. F., et al., 2016, @doi [ ] 10.3847/0004-637X/818/2/145 , http://cdsads.u-strasbg.fr/abs/2016ApJ...818..145B 818, 145

    2016 doi

  16. [24]

    E., Garc \' a L

    Brandi E., Quiroga C., Miko ajewska J., Ferrer O. E., Garc \' a L. G., 2009, @doi [ ] 10.1051/0004-6361/200811417 , http://cdsads.u-strasbg.fr/abs/2009A

    2009 doi

  17. [25]

    A., Esipov V

    Burlak M. A., Esipov V. F., Komissarova G. V., Shenavrin V. I., Taranova O. G., Tatarnikov A. M., Tatarnikova A. A., 2015, @doi [Baltic Astronomy] 10.1515/astro-2017-0209 , https://ui.adsabs.harvard.edu/abs/2015BaltA..24..109B 24, 109

    2015 doi

  18. [26]

    Cameron E., 2011, @doi [Publications of the Astronomical Society of Australia] 10.1071/AS10046 , https://ui.adsabs.harvard.edu/abs/2011PASA...28..128C 28, 128

    2011 doi

  19. [27]

    C., et al., 2016, @doi [ ] 10.3847/0004-637X/826/2/142 , http://cdsads.u-strasbg.fr/abs/2016ApJ...826..142C 826, 142

    Cheung C. C., et al., 2016, @doi [ ] 10.3847/0004-637X/826/2/142 , http://cdsads.u-strasbg.fr/abs/2016ApJ...826..142C 826, 142

    2016 doi

  20. [28]

    C., et al., 2022, @doi [ ] 10.3847/1538-4357/ac7eb7 , https://ui.adsabs.harvard.edu/abs/2022ApJ...935...44C 935, 44

    Cheung C. C., et al., 2022, @doi [ ] 10.3847/1538-4357/ac7eb7 , https://ui.adsabs.harvard.edu/abs/2022ApJ...935...44C 935, 44

    2022 doi

  21. [29]

    Chochol D., et al., 2006, @doi [Chinese Journal of Astronomy and Astrophysics Supplement] 10.1088/1009-9271/6/S1/16 , https://ui.adsabs.harvard.edu/abs/2006ChJAS...6a.137C 6, 137

    2006 doi

  22. [30]

    D., Shen K

    Chomiuk L., Metzger B. D., Shen K. J., 2021a, @doi [ ] 10.1146/annurev-astro-112420-114502 , https://ui.adsabs.harvard.edu/abs/2021ARA&A..59..391C 59, 391

    doi

  23. [31]

    Chomiuk L., et al., 2021b, @doi [ ] 10.3847/1538-4365/ac24ab , https://ui.adsabs.harvard.edu/abs/2021ApJS..257...49C 257, 49

    doi

  24. [32]

    M., Bildsten L., 2015, @doi [ ] 10.1088/0004-637X/803/2/76 , https://ui.adsabs.harvard.edu/abs/2015ApJ...803...76C 803, 76

    Cunningham T., Wolf W. M., Bildsten L., 2015, @doi [ ] 10.1088/0004-637X/803/2/76 , https://ui.adsabs.harvard.edu/abs/2015ApJ...803...76C 803, 76

    2015 doi

  25. [33]

    J., 2021, in The Golden Age of Cataclysmic Variables and Related Objects V

    Darnley M. J., 2021, in The Golden Age of Cataclysmic Variables and Related Objects V. p. 44 ( @eprint arXiv 1912.13209 ), @doi 10.22323/1.368.0044

    2021 arXiv

  26. [34]

    J., Henze M., 2020, @doi [Advances in Space Research] 10.1016/j.asr.2019.09.044 , https://ui.adsabs.harvard.edu/abs/2020AdSpR..66.1147D 66, 1147

    Darnley M. J., Henze M., 2020, @doi [Advances in Space Research] 10.1016/j.asr.2019.09.044 , https://ui.adsabs.harvard.edu/abs/2020AdSpR..66.1147D 66, 1147

    2020 doi

  27. [35]

    K., Banerjee D

    Das R. K., Banerjee D. P. K., Ashok N. M., Chesneau O., 2008, @doi [ ] 10.1111/j.1365-2966.2008.13998.x , https://ui.adsabs.harvard.edu/abs/2008MNRAS.391.1874D 391, 1874

    2008

  28. [36]

    De K., et al., 2020, @doi [ ] 10.1088/1538-3873/ab6069 , https://ui.adsabs.harvard.edu/abs/2020PASP..132b5001D 132, 025001

    2020 doi

  29. [37]

    De K., et al., 2021, @doi [ ] 10.3847/1538-4357/abeb75 , https://ui.adsabs.harvard.edu/abs/2021ApJ...912...19D 912, 19

    2021 doi

  30. [38]

    Della Valle M., Izzo L., 2020, @doi [ ] 10.1007/s00159-020-0124-6 , https://ui.adsabs.harvard.edu/abs/2020A&ARv..28....3D 28, 3

    2020 doi

  31. [39]

    Della Valle M., Livio M., 1998, @doi [ ] 10.1086/306275 , https://ui.adsabs.harvard.edu/abs/1998ApJ...506..818D 506, 818

    1998 doi

  32. [40]

    della Valle M., Bianchini A., Livio M., Orio M., 1992, , https://ui.adsabs.harvard.edu/abs/1992A&A...266..232D 266, 232

    1992

  33. [41]

    M., Metzger B

    Derdzinski A. M., Metzger B. D., Lazzati D., 2017, @doi [ ] 10.1093/mnras/stx829 , http://cdsads.u-strasbg.fr/abs/2017MNRAS.469.1314D 469, 1314

    2017 doi

  34. [42]

    S., 2000, @doi [ ] 10.1029/1999JA900192 , https://ui.adsabs.harvard.edu/abs/2000JGR...10510363E 105, 10363

    Ebel D. S., 2000, @doi [ ] 10.1029/1999JA900192 , https://ui.adsabs.harvard.edu/abs/2000JGR...10510363E 105, 10363

    2000 doi

  35. [43]

    369, IAU Colloq

    Evans A., 1990, in Cassatella A., Viotti R., eds, , Vol. 369, IAU Colloq. 122: Physics of Classical Novae. Springer-Verlag, Berlin, Germany; New York, NY, p. 253, @doi 10.1007/3-540-53500-4_133

    1990 doi

  36. [44]

    Evans A., 1997, @doi [ ] 10.1023/A:1000735511988 , https://ui.adsabs.harvard.edu/abs/1997Ap&SS.251..293E 251, 293

    1997 doi

  37. [45]

    Evans A., 2001, @doi [ ] 10.1023/A:1002725027332 , https://ui.adsabs.harvard.edu/abs/2001Ap&SS.275..131E 275, 131

    2001 doi

  38. [46]

    D., 2012, Bulletin of the Astronomical Society of India, https://ui.adsabs.harvard.edu/abs/2012BASI...40..213E 40, 213

    Evans A., Gehrz R. D., 2012, Bulletin of the Astronomical Society of India, https://ui.adsabs.harvard.edu/abs/2012BASI...40..213E 40, 213

    2012

  39. [47]

    Evans E., Rawlings J. M. C., 2008, in Classical Novae, 2nd Edition. Edited by M.F. Bode and A. Evans. Cambridge Astrophysics Series, No. 43, Cambridge: Cambridge University Press, 2008.. pp 308--334

    2008

  40. [48]

    Evans A., et al., 2007, @doi [ ] 10.1086/524944 , https://ui.adsabs.harvard.edu/abs/2007ApJ...671L.157E 671, L157

    2007 doi

  41. [49]

    Evans A., et al., 2010, @doi [ ] 10.1111/j.1745-3933.2010.00887.x , https://ui.adsabs.harvard.edu/abs/2010MNRAS.406L..85E 406, L85

    2010

  42. [50]

    Evans A., et al., 2017, @doi [ ] 10.1093/mnras/stw3334 , https://ui.adsabs.harvard.edu/abs/2017MNRAS.466.4221E 466, 4221

    2017 doi

  43. [51]

    C., Buson S., 2018, @doi [ ] 10.1051/0004-6361/201731516 , http://cdsads.u-strasbg.fr/abs/2018A

    Franckowiak A., Jean P., Wood M., Cheung C. C., Buson S., 2018, @doi [ ] 10.1051/0004-6361/201731516 , http://cdsads.u-strasbg.fr/abs/2018A

    2018 doi

  44. [52]

    Gaia Collaboration et al., 2016, @doi [ ] 10.1051/0004-6361/201629272 , https://ui.adsabs.harvard.edu/abs/2016A&A...595A...1G 595, A1

    2016 doi

  45. [53]

    Gaia Collaboration et al., 2023, @doi [ ] 10.1051/0004-6361/202243940 , https://ui.adsabs.harvard.edu/abs/2023A&A...674A...1G 674, A1

    2023 doi

  46. [54]

    S., 1977, @doi [ ] 10.1086/112032 , https://ui.adsabs.harvard.edu/abs/1977AJ.....82..209G 82, 209

    Gallagher J. S., 1977, @doi [ ] 10.1086/112032 , https://ui.adsabs.harvard.edu/abs/1977AJ.....82..209G 82, 209

    1977 doi

  47. [55]

    S., Anderson C

    Gallagher J. S., Anderson C. M., 1976, @doi [ ] 10.1086/154121 , https://ui.adsabs.harvard.edu/abs/1976ApJ...203..625G 203, 625

    1976 doi

  48. [56]

    S., Starrfield S., 1978, @doi [ ] 10.1146/annurev.aa.16.090178.001131 , http://cdsads.u-strasbg.fr/abs/1978ARA

    Gallagher J. S., Starrfield S., 1978, @doi [ ] 10.1146/annurev.aa.16.090178.001131 , http://cdsads.u-strasbg.fr/abs/1978ARA

    1978

  49. [57]

    D., 1988, @doi [ ] 10.1146/annurev.aa.26.090188.002113 , https://ui.adsabs.harvard.edu/abs/1988ARA&A..26..377G 26, 377

    Gehrz R. D., 1988, @doi [ ] 10.1146/annurev.aa.26.090188.002113 , https://ui.adsabs.harvard.edu/abs/1988ARA&A..26..377G 26, 377

    1988

  50. [58]

    D., 2002, in Hernanz M., Jos \'e J., eds, American Institute of Physics Conference Series Vol

    Gehrz R. D., 2002, in Hernanz M., Jos \'e J., eds, American Institute of Physics Conference Series Vol. 637, Classical Nova Explosions. AIP, pp 198--207, @doi 10.1063/1.1518200

    2002 doi

  51. [59]

    D., 2008, in Classical Novae, 2nd Edition

    Gehrz R. D., 2008, in Classical Novae, 2nd Edition. Edited by M.F. Bode and A. Evans. Cambridge Astrophysics Series, No. 43, Cambridge: Cambridge University Press, 2008.. pp 167--193

    2008

  52. [60]

    D., Truran J

    Gehrz R. D., Truran J. W., Williams R. E., Starrfield S., 1998, @doi [ ] 10.1086/316107 , https://ui.adsabs.harvard.edu/abs/1998PASP..110....3G 110, 3

    1998 doi

  53. [61]

    D., et al., 2015, @doi [ ] 10.1088/0004-637X/812/2/132 , https://ui.adsabs.harvard.edu/abs/2015ApJ...812..132G 812, 132

    Gehrz R. D., et al., 2015, @doi [ ] 10.1088/0004-637X/812/2/132 , https://ui.adsabs.harvard.edu/abs/2015ApJ...812..132G 812, 132

    2015 doi

  54. [62]

    D., et al., 2018, @doi [ ] 10.3847/1538-4357/aaba81 , http://cdsads.u-strasbg.fr/abs/2018ApJ...858...78G 858, 78

    Gehrz R. D., et al., 2018, @doi [ ] 10.3847/1538-4357/aaba81 , http://cdsads.u-strasbg.fr/abs/2018ApJ...858...78G 858, 78

    2018 doi

  55. [63]

    L., Kleinmann D

    Geisel S. L., Kleinmann D. E., Low F. J., 1970, @doi [ ] 10.1086/180579 , https://ui.adsabs.harvard.edu/abs/1970ApJ...161L.101G 161, L101

    1970 doi

  56. [64]

    C., Aydi E., Page K

    Gordon A. C., Aydi E., Page K. L., Li K.-L., Chomiuk L., Sokolovsky K. V., Mukai K., Seitz J., 2021, @doi [ ] 10.3847/1538-4357/abe547 , https://ui.adsabs.harvard.edu/abs/2021ApJ...910..134G 910, 134

    2021 doi

  57. [65]

    R., Das R., Pandey R., Ashok N

    Habtie G. R., Das R., Pandey R., Ashok N. M., Dubovsky P. A., 2024, @doi [ ] 10.1093/mnras/stad3295 , https://ui.adsabs.harvard.edu/abs/2024MNRAS.527.1405H 527, 1405

    2024 doi

  58. [66]

    Hamada R., et al., 2024, The Astronomer's Telegram, https://ui.adsabs.harvard.edu/abs/2024ATel16824....1H 16824, 1

    2024

  59. [67]

    A., et al., 2012, @doi [ ] 10.1088/0004-637X/755/1/37 , https://ui.adsabs.harvard.edu/abs/2012ApJ...755...37H 755, 37

    Helton L. A., et al., 2012, @doi [ ] 10.1088/0004-637X/755/1/37 , https://ui.adsabs.harvard.edu/abs/2012ApJ...755...37H 755, 37

    2012 doi

  60. [68]

    Hounsell R., et al., 2010, @doi [ ] 10.1088/0004-637X/724/1/480 , http://cdsads.u-strasbg.fr/abs/2010ApJ...724..480H 724, 480

    2010 doi

  61. [69]

    Ivezi \'c Z ., et al., 2019, @doi [ ] 10.3847/1538-4357/ab042c , https://ui.adsabs.harvard.edu/abs/2019ApJ...873..111I 873, 111

    2019 doi

  62. [70]

    Jos \'e J., Hernanz M., 2007, @doi [ ] 10.1111/j.1945-5100.2007.tb00565.x , https://ui.adsabs.harvard.edu/abs/2007M&PS...42.1135J 42, 1135

    2007

  63. [71]

    Joshi V., Banerjee D. P. K., Ashok N. M., Venkataraman V., Walter F. M., 2015, @doi [ ] 10.1093/mnras/stv1544 , https://ui.adsabs.harvard.edu/abs/2015MNRAS.452.3696J 452, 3696

    2015 doi

  64. [72]

    M., Cenko S

    Kasliwal M. M., Cenko S. B., Kulkarni S. R., Ofek E. O., Quimby R., Rau A., 2011, @doi [ ] 10.1088/0004-637X/735/2/94 , https://ui.adsabs.harvard.edu/abs/2011ApJ...735...94K 735, 94

    2011 doi

  65. [73]

    Kawash A., et al., 2021a, @doi [ ] 10.3847/1538-4357/abe53d , https://ui.adsabs.harvard.edu/abs/2021ApJ...910..120K 910, 120

    doi

  66. [74]

    Kawash A., et al., 2021b, @doi [ ] 10.3847/1538-4357/ac1f1a , https://ui.adsabs.harvard.edu/abs/2021ApJ...922...25K 922, 25

    doi

  67. [75]

    Kawash A., et al., 2022, @doi [ ] 10.3847/1538-4357/ac8d5e , https://ui.adsabs.harvard.edu/abs/2022ApJ...937...64K 937, 64

    2022 doi

  68. [76]

    K., 2023, Observations from the AAVSO International Database, https://www.aavso.org

    Kloppenborg B. K., 2023, Observations from the AAVSO International Database, https://www.aavso.org . AAVSO

    2023

  69. [77]

    S., et al., 2017, @doi [ ] 10.1088/1538-3873/aa80d9 , http://adsabs.harvard.edu/abs/2017PASP..129j4502K 129, 104502

    Kochanek C. S., et al., 2017, @doi [ ] 10.1088/1538-3873/aa80d9 , http://adsabs.harvard.edu/abs/2017PASP..129j4502K 129, 104502

    2017 doi

  70. [78]

    M., et al., 2022, @doi [Nature Astronomy] 10.1038/s41550-022-01812-x , https://ui.adsabs.harvard.edu/abs/2022NatAs...6.1308L 6, 1308

    Lau R. M., et al., 2022, @doi [Nature Astronomy] 10.1038/s41550-022-01812-x , https://ui.adsabs.harvard.edu/abs/2022NatAs...6.1308L 6, 1308

    2022 doi

  71. [79]

    Liller W., Monard L. A. G., 2009, , https://ui.adsabs.harvard.edu/abs/2009IAUC.9042....1L 9042, 1

    2009

  72. [80]

    Liller W., Heathcote B., di Scala G., Allen W., 2007, , https://ui.adsabs.harvard.edu/abs/2007JAVSO..35..359L 35, 359

    2007

  73. [81]

    D., et al., 2017, @doi [ ] 10.3847/1538-4357/aa7512 , https://ui.adsabs.harvard.edu/abs/2017ApJ...842...73L 842, 73

    Linford J. D., et al., 2017, @doi [ ] 10.3847/1538-4357/aa7512 , https://ui.adsabs.harvard.edu/abs/2017ApJ...842...73L 842, 73

    2017 doi

  74. [82]

    P., et al., 2020, in Evans C

    Lourie N. P., et al., 2020, in Evans C. J., Bryant J. J., Motohara K., eds, Society of Photo-Optical Instrumentation Engineers (SPIE) Conference Series Vol. 11447, Ground-based and Airborne Instrumentation for Astronomy VIII. p. 114479K ( @eprint arXiv 2102.01109 ), @doi 10.11...

    2020 arXiv

  75. [83]

    D., Hasco \"e t R., Vurm I., Beloborodov A

    Metzger B. D., Hasco \"e t R., Vurm I., Beloborodov A. M., Chomiuk L., Sokoloski J. L., Nelson T., 2014, @doi [ ] 10.1093/mnras/stu844 , http://cdsads.u-strasbg.fr/abs/2014MNRAS.442..713M 442, 713

    2014 doi

  76. [84]

    D., Finzell T., Vurm I., Hasco \"e t R., Beloborodov A

    Metzger B. D., Finzell T., Vurm I., Hasco \"e t R., Beloborodov A. M., Chomiuk L., 2015, @doi [ ] 10.1093/mnras/stv742 , http://cdsads.u-strasbg.fr/abs/2015MNRAS.450.2739M 450, 2739

    2015 doi

  77. [85]

    E., Ringwald F

    Morgan G. E., Ringwald F. A., Buil C., Garrett M., 2005, @doi [ ] 10.1086/432227 , https://ui.adsabs.harvard.edu/abs/2005PASP..117..938M 117, 938

    2005 doi

  78. [86]

    Mr \'o z P., et al., 2016, @doi [ ] 10.3847/0067-0049/222/1/9 , https://ui.adsabs.harvard.edu/abs/2016ApJS..222....9M 222, 9

    2016 doi

  79. [87]

    Mukai K., Orio M., Della Valle M., 2008, @doi [ ] 10.1086/529362 , https://ui.adsabs.harvard.edu/abs/2008ApJ...677.1248M 677, 1248

    2008 doi

  80. [88]

    Munari U., Banerjee D. P. K., 2018, @doi [ ] 10.1093/mnras/stx3192 , https://ui.adsabs.harvard.edu/abs/2018MNRAS.475..508M 475, 508

    2018 doi

  81. [89]

    J., Frigo A., 2017, @doi [ ] 10.1093/mnras/stx1116 , https://ui.adsabs.harvard.edu/abs/2017MNRAS.469.4341M 469, 4341

    Munari U., Hambsch F. J., Frigo A., 2017, @doi [ ] 10.1093/mnras/stx1116 , https://ui.adsabs.harvard.edu/abs/2017MNRAS.469.4341M 469, 4341

    2017 doi

  82. [90]

    Naito H., et al., 2012, @doi [ ] 10.1051/0004-6361/201118315 , https://ui.adsabs.harvard.edu/abs/2012A&A...543A..86N 543, A86

    2012 doi

  83. [91]

    P., Hatfield B

    Ney E. P., Hatfield B. F., 1978, @doi [ ] 10.1086/182618 , http://cdsads.u-strasbg.fr/abs/1978ApJ...219L.111N 219, L111

    1978 doi

  84. [92]

    Nishimura H., Nakano S., 2012, Central Bureau Electronic Telegrams, https://ui.adsabs.harvard.edu/abs/2012CBET.3166....1N 3166, 1

    2012

  85. [93]

    J., Bode M

    O'Brien T. J., Bode M. F., 2008, in Classical Novae, 2nd Edition. Edited by M.F. Bode and A. Evans. Cambridge Astrophysics Series, No. 43, Cambridge: Cambridge University Press, 2008.. pp 285--306

    2008

  86. [94]

    L., Beardmore A

    Page K. L., Beardmore A. P., Osborne J. P., 2020, @doi [Advances in Space Research] 10.1016/j.asr.2019.08.003 , https://ui.adsabs.harvard.edu/abs/2020AdSpR..66.1169P 66, 1169

    2020 doi

  87. [95]

    Payne-Gaposchkin C. H. P., 1957, The galactic novae. Amsterdam, North-Holland Pub. Co.; New York, Interscience Publishers . Amsterdam, North-Holland Pub. Co.; New York, Interscience Publishers

    1957

  88. [96]

    Rawlings J. M. C., 1988, @doi [ ] 10.1093/mnras/232.3.507 , https://ui.adsabs.harvard.edu/abs/1988MNRAS.232..507R 232, 507

    1988 doi

  89. [97]

    Rawlings J. M. C., Williams D. A., 1989, @doi [ ] 10.1093/mnras/240.3.729 , https://ui.adsabs.harvard.edu/abs/1989MNRAS.240..729R 240, 729

    1989 doi

  90. [98]

    Sakon I., et al., 2016, @doi [ ] 10.3847/0004-637X/817/2/145 , https://ui.adsabs.harvard.edu/abs/2016ApJ...817..145S 817, 145

    2016 doi

  91. [99]

    N., Kazarovets E., 2004, , https://ui.adsabs.harvard.edu/abs/2004IAUC.8445....2S 8445, 2

    Samus N. N., Kazarovets E., 2004, , https://ui.adsabs.harvard.edu/abs/2004IAUC.8445....2S 8445, 2

    2004

  92. [100]

    E., 2010, @doi [ ] 10.1088/0067-0049/187/2/275 , https://ui.adsabs.harvard.edu/abs/2010ApJS..187..275S 187, 275

    Schaefer B. E., 2010, @doi [ ] 10.1088/0067-0049/187/2/275 , https://ui.adsabs.harvard.edu/abs/2010ApJS..187..275S 187, 275

    2010 doi

  93. [101]

    E., 2018, @doi [ ] 10.1093/mnras/sty2388 , https://ui.adsabs.harvard.edu/abs/2018MNRAS.481.3033S 481, 3033

    Schaefer B. E., 2018, @doi [ ] 10.1093/mnras/sty2388 , https://ui.adsabs.harvard.edu/abs/2018MNRAS.481.3033S 481, 3033

    2018 doi

  94. [102]

    E., 2022, @doi [ ] 10.1093/mnras/stac2900 , https://ui.adsabs.harvard.edu/abs/2022MNRAS.517.6150S 517, 6150

    Schaefer B. E., 2022, @doi [ ] 10.1093/mnras/stac2900 , https://ui.adsabs.harvard.edu/abs/2022MNRAS.517.6150S 517, 6150

    2022 doi

  95. [103]

    F., Finkbeiner D

    Schlafly E. F., Finkbeiner D. P., 2011, @doi [ ] 10.1088/0004-637X/737/2/103 , http://adsabs.harvard.edu/abs/2011ApJ...737..103S 737, 103

    2011 doi

  96. [104]

    J., et al., 2011, @doi [ ] 10.1088/0067-0049/197/2/31 , http://cdsads.u-strasbg.fr/abs/2011ApJS..197...31S 197, 31

    Schwarz G. J., et al., 2011, @doi [ ] 10.1088/0067-0049/197/2/31 , http://cdsads.u-strasbg.fr/abs/2011ApJS..197...31S 197, 31

    2011 doi

  97. [105]

    J., et al., 2015, @doi [ ] 10.1088/0004-6256/149/3/95 , http://cdsads.u-strasbg.fr/abs/2015AJ....149...95S 149, 95

    Schwarz G. J., et al., 2015, @doi [ ] 10.1088/0004-6256/149/3/95 , http://cdsads.u-strasbg.fr/abs/2015AJ....149...95S 149, 95

    2015 doi

  98. [106]

    W., 2017, @doi [ ] 10.3847/1538-4357/834/2/196 , https://ui.adsabs.harvard.edu/abs/2017ApJ...834..196S 834, 196

    Shafter A. W., 2017, @doi [ ] 10.3847/1538-4357/834/2/196 , https://ui.adsabs.harvard.edu/abs/2017ApJ...834..196S 834, 196

    2017 doi

  99. [107]

    W., Bode M

    Shafter A. W., Bode M. F., Darnley M. J., Misselt K. A., Rubin M., Hornoch K., 2011a, @doi [ ] 10.1088/0004-637X/727/1/50 , https://ui.adsabs.harvard.edu/abs/2011ApJ...727...50S 727, 50

    doi

  100. [108]

    W., et al., 2011b, @doi [ ] 10.1088/0004-637X/734/1/12 , http://adsabs.harvard.edu/abs/2011ApJ...734...12S 734, 12

    Shafter A. W., et al., 2011b, @doi [ ] 10.1088/0004-637X/734/1/12 , http://adsabs.harvard.edu/abs/2011ApJ...734...12S 734, 12

    doi

  101. [109]

    W., Clark J

    Shafter A. W., Clark J. G., Hornoch K., 2023, @doi [Research Notes of the American Astronomical Society] 10.3847/2515-5172/acf5e8 , https://ui.adsabs.harvard.edu/abs/2023RNAAS...7..191S 7, 191

    2023 doi

  102. [110]

    J., et al., 2014, @doi [ ] 10.1088/0004-637X/788/1/48 , http://adsabs.harvard.edu/abs/2014ApJ...788...48S 788, 48

    Shappee B. J., et al., 2014, @doi [ ] 10.1088/0004-637X/788/1/48 , http://adsabs.harvard.edu/abs/2014ApJ...788...48S 788, 48

    2014 doi

  103. [111]

    M., 1981, @doi [ ] 10.1086/158657 , http://cdsads.u-strasbg.fr/abs/1981ApJ...243..926S 243, 926

    Shara M. M., 1981, @doi [ ] 10.1086/158657 , http://cdsads.u-strasbg.fr/abs/1981ApJ...243..926S 243, 926

    1981 doi

  104. [112]

    M., et al., 2016, @doi [ ] 10.3847/0067-0049/227/1/1 , https://ui.adsabs.harvard.edu/abs/2016ApJS..227....1S 227, 1

    Shara M. M., et al., 2016, @doi [ ] 10.3847/0067-0049/227/1/1 , https://ui.adsabs.harvard.edu/abs/2016ApJS..227....1S 227, 1

    2016 doi

  105. [113]

    N., Kuin N

    Shore S. N., Kuin N. P., Mason E., De Gennaro Aquino I., 2018, @doi [ ] 10.1051/0004-6361/201833204 , http://cdsads.u-strasbg.fr/abs/2018A

    2018 doi

  106. [114]

    V., et al., 2020, @doi [ ] 10.1093/mnras/staa2104 , https://ui.adsabs.harvard.edu/abs/2020MNRAS.497.2569S 497, 2569

    Sokolovsky K. V., et al., 2020, @doi [ ] 10.1093/mnras/staa2104 , https://ui.adsabs.harvard.edu/abs/2020MNRAS.497.2569S 497, 2569

    2020 doi

  107. [115]

    V., et al., 2022, @doi [ ] 10.1093/mnras/stac1440 , https://ui.adsabs.harvard.edu/abs/2022MNRAS.514.2239S 514, 2239

    Sokolovsky K. V., et al., 2022, @doi [ ] 10.1093/mnras/stac1440 , https://ui.adsabs.harvard.edu/abs/2022MNRAS.514.2239S 514, 2239

    2022 doi

  108. [116]

    V., et al., 2023, @doi [ ] 10.1093/mnras/stad887 , https://ui.adsabs.harvard.edu/abs/2023MNRAS.521.5453S 521, 5453

    Sokolovsky K. V., et al., 2023, @doi [ ] 10.1093/mnras/stad887 , https://ui.adsabs.harvard.edu/abs/2023MNRAS.521.5453S 521, 5453

    2023 doi

  109. [117]

    K., Banerjee D

    Srivastava M. K., Banerjee D. P. K., Ashok N. M., Venkataraman V., Sand D., Diamond T., 2016, @doi [ ] 10.1093/mnras/stw1807 , https://ui.adsabs.harvard.edu/abs/2016MNRAS.462.2074S 462, 2074

    2016 doi

  110. [118]

    J., Schaefer B

    Strope R. J., Schaefer B. E., Henden A. A., 2010, @doi [ ] 10.1088/0004-6256/140/1/34 , http://adsabs.harvard.edu/abs/2010AJ....140...34S 140, 34

    2010 doi

  111. [119]

    M., Capps R

    Szkody P., Dyck H. M., Capps R. W., Becklin E. E., Cruikshank D. P., 1979, @doi [ ] 10.1086/112551 , https://ui.adsabs.harvard.edu/abs/1979AJ.....84.1359S 84, 1359

    1979 doi

  112. [120]

    V., 1991, @doi [ ] 10.1093/mnras/252.1.49 , https://ui.adsabs.harvard.edu/abs/1991MNRAS.252...49U 252, 49

    Usov V. V., 1991, @doi [ ] 10.1093/mnras/252.1.49 , https://ui.adsabs.harvard.edu/abs/1991MNRAS.252...49U 252, 49

    1991 doi

  113. [121]

    F., 1987, , http://cdsads.u-strasbg.fr/abs/1987A

    van den Bergh S., Younger P. F., 1987, , http://cdsads.u-strasbg.fr/abs/1987A

    1987

  114. [122]

    M., Battisti A., Towers S

    Walter F. M., Battisti A., Towers S. E., Bond H. E., Stringfellow G. S., 2012, @doi [ ] 10.1086/668404 , http://cdsads.u-strasbg.fr/abs/2012PASP..124.1057W 124, 1057

    2012 doi

  115. [123]

    Edited by M.F

    Warner B., 2008, in Classical Novae, 2nd Edition. Edited by M.F. Bode and A. Evans. Cambridge Astrophysics Series, No. 43, Cambridge: Cambridge University Press, 2008.. pp 16--33

    2008

  116. [124]

    Wee J., et al., 2020, @doi [ ] 10.3847/1538-4357/aba3cc , https://ui.adsabs.harvard.edu/abs/2020ApJ...899..162W 899, 162

    2020 doi

  117. [125]

    E., 1990, in Cassatella A., Viotti R., eds, , Vol

    Williams R. E., 1990, in Cassatella A., Viotti R., eds, , Vol. 369, IAU Colloq. 122: Physics of Classical Novae. Springer-Verlag, Berlin, Germany; New York, NY, p. 215, @doi 10.1007/3-540-53500-4_12910.1007/3-540-53500-4

    1990

  118. [126]

    E., 1994, @doi [ ] 10.1086/174062 , https://ui.adsabs.harvard.edu/abs/1994ApJ...426..279W 426, 279

    Williams R. E., 1994, @doi [ ] 10.1086/174062 , https://ui.adsabs.harvard.edu/abs/1994ApJ...426..279W 426, 279

    1994 doi

  119. [127]

    Williams R., 2013, @doi [ ] 10.1088/0004-6256/146/3/55 , http://cdsads.u-strasbg.fr/abs/2013AJ....146...55W 146, 55

    2013 doi

  120. [128]

    C., Bode M

    Williams S. C., Bode M. F., Darnley M. J., Evans A., Zubko V., Shafter A. W., 2013, @doi [ ] 10.1088/2041-8205/777/2/L32 , https://ui.adsabs.harvard.edu/abs/2013ApJ...777L..32W 777, L32

    2013 doi

  121. [129]

    M., Bildsten L., Brooks J., Paxton B., 2013, @doi [ ] 10.1088/0004-637X/777/2/136 , http://cdsads.u-strasbg.fr/abs/2013ApJ...777..136W 777, 136

    Wolf W. M., Bildsten L., Brooks J., Paxton B., 2013, @doi [ ] 10.1088/0004-637X/777/2/136 , http://cdsads.u-strasbg.fr/abs/2013ApJ...777..136W 777, 136

    2013 doi

  122. [130]

    E., Banerjee D

    Woodward C. E., Banerjee D. P. K., Evans A., Wagner R. M., Starrfield S., 2021, The Astronomer's Telegram, https://ui.adsabs.harvard.edu/abs/2021ATel14741....1W 14741, 1

    2021

  123. [131]

    A., et al., 2009, @doi [ ] 10.1088/0004-637X/706/1/738 , https://ui.adsabs.harvard.edu/abs/2009ApJ...706..738W 706, 738

    Woudt P. A., et al., 2009, @doi [ ] 10.1088/0004-637X/706/1/738 , https://ui.adsabs.harvard.edu/abs/2009ApJ...706..738W 706, 738

    2009 doi

  124. [132]

    Wyrzykowski L., Udalski A., Kozlowski S., Skowron J., 2013, The Astronomer's Telegram, https://ui.adsabs.harvard.edu/abs/2013ATel.5491....1W 5491, 1

    2013

  125. [133]

    Yama H., et al., 2023, @doi [Journal of Astronomical Instrumentation] 10.1142/S2251171723500046 , https://ui.adsabs.harvard.edu/abs/2023JAI....1250004Y 12, 2350004

    2023 doi

  126. [134]

    M., Kovetz A., 2005, @doi [ ] 10.1086/428435 , http://cdsads.u-strasbg.fr/abs/2005ApJ...623..398Y 623, 398

    Yaron O., Prialnik D., Shara M. M., Kovetz A., 2005, @doi [ ] 10.1086/428435 , http://cdsads.u-strasbg.fr/abs/2005ApJ...623..398Y 623, 398

    2005 doi

  127. [135]

    M., Panagiotou C., 2023, @doi [ ] 10.1093/mnras/stad1625 , https://ui.adsabs.harvard.edu/abs/2023MNRAS.523.3555Z 523, 3555

    Zuckerman L., De K., Eilers A.-C., Meisner A. M., Panagiotou C., 2023, @doi [ ] 10.1093/mnras/stad1625 , https://ui.adsabs.harvard.edu/abs/2023MNRAS.523.3555Z 523, 3555

    2023 doi

  128. [136]

    write newline

    " write newline "" before.all 'output.state := FUNCTION fin.entry write newline FUNCTION new.block output.state before.all = 'skip after.block 'output.state := if FUNCTION new.sentence output.state after.block = 'skip output.state before.all = 'skip after.sentence 'output.stat...

  129. [137]

    write newline

    " write newline "" before.all 'output.state := FUNCTION fin.entry write newline FUNCTION new.block output.state before.all = 'skip after.block 'output.state := if FUNCTION new.sentence output.state after.block = 'skip output.state before.all = 'skip after.sentence 'output.stat...

Pith tools

Reviewed August 10, 2026 · model on record in the stance chip above.