Additive Energy and Irregularities of Distribution
classification
🧮 math.NT
math.CAmath.CO
keywords
leftrightalphaadditiveenergysequencesalmostassertion
read the original abstract
We consider strictly increasing sequences $\left(a_{n}\right)_{n \geq 1}$ of integers and sequences of fractional parts $\left(\left\{a_{n} \alpha\right\}\right)_{n \geq 1}$ where $\alpha \in \mathbb{R}$. We show that a small additive energy of $\left(a_{n}\right)_{n \geq 1}$ implies that for almost all $\alpha$ the sequence $\left(\left\{a_{n} \alpha\right\}\right)_{n \geq 1}$ has large discrepancy. We prove a general result, provide various examples, and show that the converse assertion is not necessarily true.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.