Pith. sign in

REVIEW 2 major objections 1 minor 71 references

Wave Focusing in Metamaterials: Tactile Displays Beyond the Diffraction Limit

T0 review · 2 major / 1 minor · reviewed 2026-06-27 · grok-4.3

Pith's one-line read Adding a lattice of resonators to a flexural plate introduces a slow-wave branch that focuses tactile waves beyond the diffraction limit.

desk verdict The paper shows a resonator lattice on a flexural plate that creates a slow-wave branch for sub-diffraction tactile focusing, with experiments claiming a tenfold virtual-pixel area reduction and perceptual validation. read the letter →

arxiv 2606.05572 v1 pith:JVBE7G6O submitted 2026-06-04 cs.ET cs.HCcs.ROphysics.app-ph

classification cs.ETcs.HCcs.ROphysics.app-ph
keywords metamaterialtactiledisplaywavefocusingflexuralplatehapticfeedbackdiffractionlimitmechanicalresonatorsslow-wavepropagation
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper shows that coupling a plate's vibration modes with attached mechanical resonators changes how waves propagate across it. This change creates a slow-wave branch in the dispersion relation, allowing focused vibrations at scales smaller than what diffraction normally permits on a plain plate. The result is virtual tactile pixels whose area is reduced by a factor of ten, demonstrated in both simulation and a physical prototype. A reader would care because this makes it possible to create high-resolution haptic surfaces that deliver localized touch sensations at multiple points using only a few actuators.

What carries the argument

The locally resonant metamaterial plate, formed by attaching a lattice of mechanical resonators to the flexural plate, which modifies the dispersion relation to support sub-diffraction wave focusing.

What would settle it

Direct measurement of the dispersion curve on the fabricated plate showing no slow-wave branch, or failure to achieve focusing with virtual pixel area reduction by a factor of ten.

Watch

Extended reading notes

Core claim

Coupling between the plate's dynamic modes and those of the resonators alters the dispersion relation governing wave transmission, introducing a slow-wave branch that enables focusing beyond the diffraction limit imposed by the unmodified plate, resulting in a tenfold reduction in virtual-pixel area.

Load-bearing premise

The numerical simulations accurately predict the dispersion relation and focusing performance of the fabricated metamaterial device without significant unmodeled losses or fabrication deviations.

Editorial extensions

If this is right

  • Virtual tactile pixels become far more localized than on an unmodified plate.
  • Independent control over temporal waveforms is maintained at multiple display locations.
  • Perceptually localized single- and multi-point tactile feedback can be delivered.
  • Moving tactile sources can be presented on the surface.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • This method could allow high-resolution haptic feedback on large surfaces with fewer actuators than traditional approaches.
  • Similar resonator lattices might be used to control wave propagation in other mechanical systems for sensing or energy focusing.
  • Experimental validation of the slow-wave branch in real devices opens the door to optimizing resonator designs for specific tactile frequencies.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

2 major / 1 minor

Summary. The manuscript claims that coupling a lattice of mechanical resonators to a flexural plate forms a locally resonant metamaterial whose mode coupling introduces a slow-wave branch in the dispersion relation. This branch enables sub-diffraction focusing of flexural waves at tactile frequencies, yielding a tenfold reduction in virtual-pixel area relative to an unmodified plate. Numerical simulations are used to engineer the resonator parameters for the desired dispersion; a device is then fabricated and shown experimentally to produce more localized virtual pixels, with additional behavioral experiments confirming perceptually distinct single- and multi-point tactile feedback under independent temporal control.

Significance. If the experimental realization of the slow-wave branch is confirmed, the work offers a practical route to high-resolution distributed haptic displays that require only a sparse set of actuators. The combination of dispersion engineering, physical fabrication, and human-subject validation is a clear strength and directly addresses a long-standing diffraction barrier in wave-based tactile interfaces.

major comments (2)
  1. [Abstract] Abstract: the central claim of a tenfold virtual-pixel area reduction and the existence of the slow-wave branch in the fabricated device rests on experimental confirmation, yet the abstract supplies no error bars on area measurements, no quantitative baseline comparison to the unmodified plate, and no details on data exclusion or statistical tests. This directly limits verification of the load-bearing experimental result.
  2. [Dispersion engineering and experimental validation sections] Dispersion engineering and experimental validation sections: the design process relies on numerical simulations to set resonator lattice parameters for the slow-wave branch, but the manuscript provides no overlaid comparison of simulated versus measured dispersion curves or loss levels in the physical prototype. Without this match, it remains possible that fabrication deviations or unmodeled damping suppress the branch, removing the physical mechanism invoked to explain the observed focusing improvement.
minor comments (1)
  1. [Abstract] The abstract would benefit from stating the specific tactile frequency band and the number of resonators employed, to allow immediate assessment of the operating regime.

Simulated Author's Rebuttal

2 responses · 0 unresolved

We thank the referee for the constructive comments and positive overall assessment. We address each major comment below and will revise the manuscript to strengthen the presentation of the experimental results.

read point-by-point responses
  1. Referee: [Abstract] Abstract: the central claim of a tenfold virtual-pixel area reduction and the existence of the slow-wave branch in the fabricated device rests on experimental confirmation, yet the abstract supplies no error bars on area measurements, no quantitative baseline comparison to the unmodified plate, and no details on data exclusion or statistical tests. This directly limits verification of the load-bearing experimental result.

    Authors: We agree that the abstract would benefit from additional quantitative support. In the revised version we will add error bars on the reported area reduction, a direct numerical comparison to the unmodified-plate baseline, and a brief reference to the statistical tests performed. Space constraints preclude full details on data exclusion, but we will ensure the key quantitative claims are supported. revision: partial

  2. Referee: [Dispersion engineering and experimental validation sections] Dispersion engineering and experimental validation sections: the design process relies on numerical simulations to set resonator lattice parameters for the slow-wave branch, but the manuscript provides no overlaid comparison of simulated versus measured dispersion curves or loss levels in the physical prototype. Without this match, it remains possible that fabrication deviations or unmodeled damping suppress the branch, removing the physical mechanism invoked to explain the observed focusing improvement.

    Authors: We acknowledge the value of direct validation. The revised manuscript will include an overlaid plot of the simulated and experimentally measured dispersion curves together with estimated loss levels for the fabricated prototype. This addition will confirm that the slow-wave branch is present and supports the observed focusing improvement. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity; derivation follows from standard wave mechanics and experimental validation

full rationale

The paper's central claim—that resonator-plate mode coupling produces a slow-wave branch enabling sub-diffraction focusing—is derived from the physics of locally resonant metamaterials rather than any self-referential definition or fitted parameter renamed as a prediction. Numerical simulations are used only to select resonator parameters for a target dispersion relation; the subsequent fabrication and measurement then independently confirm the tenfold area reduction and perceptual localization. No load-bearing self-citations, uniqueness theorems, or ansatzes imported from prior author work appear in the provided text. The result is therefore self-contained against external physical principles and direct experimental benchmarks.

Assumptions & free parameters 1 free parameters · 1 assumptions · 0 invented entities

The central claim rests on standard linear wave mechanics in plates and the established principle that local resonators can open slow-wave branches in metamaterials; no new entities are postulated and the resonator parameters are chosen via simulation rather than fitted post hoc to the target result.

free parameters (1)
  • resonator lattice parameters
    Dimensions, mass, and stiffness chosen through numerical optimization to produce the desired dispersion relation at tactile frequencies.
assumptions (1)
  • domain assumption Linear elastic wave propagation and mode coupling govern the system response at the frequencies and amplitudes used.
    Invoked implicitly when stating that coupling alters the dispersion relation.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Wave Focusing in Metamaterials: Tactile Displays Beyond the Diffraction Limit." pith.science (2026). https://pith.science/paper/JVBE7G6O

@misc{pith2026260605572,
  author       = {Pith},
  title        = {Pith review of: Wave Focusing in Metamaterials: Tactile Displays Beyond the Diffraction Limit},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/JVBE7G6O}},
  note         = {Machine review of arXiv:2606.05572}
}
read the original abstract

We address the challenge of engineering distributed haptic displays capable of reproducing multiple localized, independently addressable vibrations -- representing virtual tactile pixels -- at arbitrary locations on a surface. Our technique is based on the focusing of mechanical waves in a flexural plate using a sparse set of actuators. At tactile frequencies, wave diffraction prevents the formation of localized virtual tactile pixels at spatial scales relevant for multi-digit touch interactions. We overcome this limitation by augmenting the plate with a lattice of mechanical resonators, forming a locally resonant metamaterial plate. Coupling between the plate's dynamic modes and those of the resonators alters the dispersion relation governing wave transmission, introducing a slow-wave branch that enables focusing beyond the diffraction limit imposed by the unmodified plate. We use numerical simulations to engineer the dispersion relation of the metamaterial system for high-resolution focusing at tactile frequencies. We then fabricate a metamaterial tactile display and experimentally demonstrate virtual pixels that are far more localized than those generated on an otherwise identical plate without resonators, resulting in a tenfold reduction in virtual-pixel area. In behavioral experiments, we show that this system can deliver perceptually localized single- and multi-point tactile feedback and moving tactile sources while maintaining independent control over temporal waveforms at multiple display locations. The methods reported here can enable high-resolution haptic displays for widespread applications using a small number of actuated degrees of freedom.

Figures

Figures reproduced from arXiv: 2606.05572 by the authors.

Figure 1
Figure 1. Computational wave field control using locally resonant metamaterials for tactile [PITH_FULL_IMAGE:figures/full_fig_p004_1.png] view at source ↗
Figure 2
Figure 2. Surface mode hybridization yields a slow-wave branch in a numerically simulated [PITH_FULL_IMAGE:figures/full_fig_p008_2.png] view at source ↗
Figure 3
Figure 3. Metamaterial tactile display for multi-touch haptics. [PITH_FULL_IMAGE:figures/full_fig_p009_3.png] view at source ↗
Figures from the paper (5 more)
Figure 4
Figure 4. Figure 4: Measured slow-wave dispersion in the metamaterial tactile display. [PITH_FULL_IMAGE:figures/full_fig_p010_4.png]
Figure 5
Figure 5. Figure 5: Metamaterial wave focusing for centimeter-scale tactile feedback: experimental [PITH_FULL_IMAGE:figures/full_fig_p011_5.png]
Figure 6
Figure 6. Figure 6: Surface mode hybridization increases spatial response dimensionality and input [PITH_FULL_IMAGE:figures/full_fig_p013_6.png]
Figure 7
Figure 7. Figure 7: Virtual pixels for multi-point tactile feedback. [PITH_FULL_IMAGE:figures/full_fig_p015_7.png]
Figure 8
Figure 8. Figure 8: Perception of multiple virtual pixels. (A) Experiment 1: Virtual pixel localization. Participants identified the active virtual pixel (left). Mean response accuracy was 98.6% (right; chance accuracy: 20%). (B) Experiment 2: Virtual pixel exploration. Participants explo…

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

71 extracted references

  1. [1]

    Hayward, O

    V . Hayward, O. R. Astley, M. Cruz-Hernandez, D. Grant, G. Robles-De-La-Torre, Haptic interfaces and devices.Sensor Review24(1), 16–29 (2004)

  2. [2]

    Basdogan, F

    C. Basdogan, F. Giraud, V . Levesque, S. Choi, A review of surface haptics: Enabling tactile effects on touch surfaces.IEEE Transactions on Haptics13(3), 450–470 (2020)

  3. [3]

    Culbertson, S

    H. Culbertson, S. B. Schorr, A. M. Okamura, Haptics: The present and future of artificial touch sensation.Annual Review of Control, Robotics, and Autonomous Systems1(1), 385–409 (2018)

  4. [4]

    D. Wang, K. Ohnishi, W. Xu, Multimodal haptic display for virtual reality: A survey.IEEE Transac- tions on Industrial Electronics67(1), 610–623 (2019)

  5. [5]

    Paneels, J

    S. Paneels, J. C. Roberts, Review of designs for haptic data visualization.IEEE Transactions on Haptics3(2), 119–137 (2009)

  6. [6]

    Pacchierotti, D

    C. Pacchierotti, D. Prattichizzo, Cutaneous/tactile haptic feedback in robotic teleoperation: Motiva- tion, survey, and perspectives.IEEE Transactions on Robotics40, 978–998 (2023)

  7. [7]

    Biswas, Y

    S. Biswas, Y . Visell, Emerging material technologies for haptics.Advanced Materials Technologies 4(4), 1900042 (2019)

  8. [8]

    Y . Ikei, K. Wakamatsu, S. Fukuda, Vibratory tactile display of image-based textures.IEEE Computer Graphics and Applications17(6), 53–61 (1997)

Show all 71 references
  1. [9]

    Ujitoko, T

    Y . Ujitoko, T. Taniguchi, S. Sakurai, K. Hirota, Development of finger-mounted high-density pin-array haptic display.IEEE Access8, 145107–145114 (2020)

  2. [10]

    V . Shen, T. Rae-Grant, J. Mullenbach, C. Harrison, C. Shultz, Fluid reality: High-resolution, un- tethered haptic gloves using electroosmotic pump arrays, inProceedings of the 36th Annual ACM Symposium on User Interface Software and Technology(ACM) (2023), pp. 1–20

  3. [11]

    Purnendu,et al., Fingertip wearable high-resolution electrohydraulic interface for multimodal haptics, in2023 IEEE World Haptics Conference(IEEE) (2023), pp. 299–305

  4. [12]

    Youn, S.-Y

    J.-H. Youn, S.-Y . Jang, I. Hwang, Q. Pei, S. Yun, K.-U. Kyung, Skin-attached haptic patch for versatile and augmented tactile interaction.Science Advances11(12), eadt4839 (2025)

  5. [13]

    S. Tan, M. A. Peskhin, R. L. Klatzky, J. E. Colgate, Toward human-resolution haptics: A high- bandwidth, high-density, wearable tactile display.Science Advances11(47), eadz5937 (2025)

  6. [14]

    M. R. Bai, Y . K. Tsai, Impact localization combined with haptic feedback for touch panel applications based on the time-reversal approach.The Journal of the Acoustical Society of America129(3), 1297–1305 (2011)

  7. [15]

    Hudin, J

    C. Hudin, J. Lozada, V . Hayward, Localized tactile feedback on a transparent surface through time-reversal wave focusing.IEEE Transactions on Haptics8(2), 188–198 (2015). 26

  8. [16]

    Woo, J.-G

    J.-H. Woo, J.-G. Ih, Vibration rendering on a thin plate with actuator array at the periphery.Journal of Sound and Vibration349, 150–162 (2015)

  9. [17]

    Katumu, J

    K. Katumu, J. L. Gorlewicz, Using modal superposition for generating localized tactile effects on variable friction touchscreens, in2016 IEEE Haptics Symposium(IEEE) (2016), pp. 211–216

  10. [18]

    S. E. Emgin, A. Aghakhani, T. M. Sezgin, C. Basdogan, HapTable: An interactive tabletop providing online haptic feedback for touch gestures.IEEE Transactions on Visualization and Computer Graphics 25(9), 2749–2762 (2018)

  11. [19]

    Hudin, S

    C. Hudin, S. Pan¨eels, Localisation of vibrotactile stimuli with spatio-temporal inverse filtering, in Haptics: Science, Technology, and Applications. EuroHaptics 2018(Springer) (2018), pp. 338–350

  12. [20]

    Pantera, C

    L. Pantera, C. Hudin, Multitouch vibrotactile feedback on a tactile screen by the inverse filter technique: Vibration amplitude and spatial resolution.IEEE Transactions on Haptics13(3), 493–503 (2020)

  13. [21]

    Reardon, N

    G. Reardon, N. Kastor, Y . Shao, Y . Visell, Elastowave: Localized tactile feedback in a soft haptic interface via focused elastic waves, in2020 IEEE Haptics Symposium(IEEE) (2020), pp. 7–14

  14. [22]

    Goetz, G

    D. Goetz, G. Reardon, M. Linnander, Y . Visell, Dynamic Feedback in Wave-Mediated Surface Haptics: A Modular Platform, in2023 IEEE World Haptics Conference(IEEE) (2023), pp. 107–113

  15. [23]

    Reardon, D

    G. Reardon, D. Goetz, M. Linnander, Y . Visell, Rendering dynamic source motion in surface haptics via wave focusing.IEEE Transactions on Haptics(2023)

  16. [24]

    M. A. Gerzon, Ambisonics in multichannel broadcasting and video.Journal of the Audio Engineering Society33(11), 859–871 (1985)

  17. [25]

    A. J. Berkhout, D. de Vries, P. V ogel, Acoustic control by wave field synthesis.The Journal of the Acoustical Society of America93(5), 2764–2778 (1993)

  18. [26]

    Pulkki, Virtual sound source positioning using vector base amplitude panning.Journal of the Audio Engineering Society45(6), 456–466 (1997)

    V . Pulkki, Virtual sound source positioning using vector base amplitude panning.Journal of the Audio Engineering Society45(6), 456–466 (1997)

  19. [27]

    Hoshi, M

    T. Hoshi, M. Takahashi, T. Iwamoto, H. Shinoda, Noncontact tactile display based on radiation pressure of airborne ultrasound.IEEE Transactions on Haptics3(3), 155–165 (2010)

  20. [28]

    Carter, S

    T. Carter, S. A. Seah, B. Long, B. Drinkwater, S. Subramanian, UltraHaptics: Multi-point mid-air haptic feedback for touch surfaces, inProceedings of the 26th Annual ACM Symposium on User Interface Software and Technology(ACM) (2013), pp. 505–514

  21. [29]

    Fink, Time reversal of ultrasonic fields

    M. Fink, Time reversal of ultrasonic fields. I. Basic principles.IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control39(5), 555–566 (1992)

  22. [30]

    Tanter, J.-F

    M. Tanter, J.-F. Aubry, J. Gerber, J.-L. Thomas, M. Fink, Optimal focusing by spatio-temporal inverse filter. I. Basic principles.The Journal of the Acoustical Society of America110(1), 37–47 (2001). 27

  23. [31]

    Aubry, M

    J.-F. Aubry, M. Tanter, J. Gerber, J.-L. Thomas, M. Fink, Optimal focusing by spatio-temporal inverse filter. II. Experiments. Application to focusing through absorbing and reverberating media. The Journal of the Acoustical Society of America110(1), 48–58 (2001)

  24. [32]

    Pernot,et al., In vivo transcranial brain surgery with an ultrasonic time reversal mirror.Journal of Neurosurgery106(6), 1061–1066 (2007)

    M. Pernot,et al., In vivo transcranial brain surgery with an ultrasonic time reversal mirror.Journal of Neurosurgery106(6), 1061–1066 (2007)

  25. [33]

    Ter Haar, C

    G. Ter Haar, C. Coussios, High intensity focused ultrasound: physical principles and devices. International Journal of Hyperthermia23(2), 89–104 (2007)

  26. [34]

    Gennisson, T

    J.-L. Gennisson, T. Deffieux, M. Fink, M. Tanter, Ultrasound elastography: Principles and techniques. Diagnostic and Interventional Imaging94(5), 487–495 (2013)

  27. [35]

    M. S. Taljanovic,et al., Shear-wave elastography: Basic physics and musculoskeletal applications. Radiographics37(3), 855–870 (2017)

  28. [36]

    Izadifar, Z

    Z. Izadifar, Z. Izadifar, D. Chapman, P. Babyn, An introduction to high intensity focused ultrasound: Systematic review on principles, devices, and clinical applications.Journal of Clinical Medicine 9(2), 460 (2020)

  29. [37]

    Sato, Response of Pacinian corpuscles to sinusoidal vibration.The Journal of Physiology159(3), 391 (1961)

    M. Sato, Response of Pacinian corpuscles to sinusoidal vibration.The Journal of Physiology159(3), 391 (1961)

  30. [38]

    R. S. Johansson, U. Landstrom, R. Lundstrom, Responses of mechanoreceptive afferent units in the glabrous skin of the human hand to sinusoidal skin displacements.Brain Research244(1), 17–25 (1982)

  31. [39]

    Lemoult, M

    F. Lemoult, M. Fink, G. Lerosey, Acoustic resonators for far-field control of sound on a subwavelength scale.Physical Review Letters107(6), 064301 (2011)

  32. [40]

    Rupin, F

    M. Rupin, F. Lemoult, G. Lerosey, P. Roux, Experimental demonstration of ordered and disordered multiresonant metamaterials for lamb waves.Physical Review Letters112(23), 234301 (2014)

  33. [41]

    Liu,et al., Locally resonant sonic materials.Science289(5485), 1734–1736 (2000)

    Z. Liu,et al., Locally resonant sonic materials.Science289(5485), 1734–1736 (2000)

  34. [42]

    Z. Yang, J. Mei, M. Yang, N. Chan, P. Sheng, Membrane-type acoustic metamaterial with negative dynamic mass.Physical Review Letters101(20), 204301 (2008)

  35. [43]

    J. Mei, G. Ma, M. Yang, Z. Yang, W. Wen, P. Sheng, Dark acoustic metamaterials as super absorbers for low-frequency sound.Nature Communications3(1), 756 (2012)

  36. [44]

    H. Peng, P. F. Pai, H. Deng, Acoustic multi-stopband metamaterial plates design for broadband elastic wave absorption and vibration suppression.International Journal of Mechanical Sciences103, 104–114 (2015)

  37. [45]

    Z. Chen, B. Guo, Y . Yang, C. Cheng, Metamaterials-based enhanced energy harvesting: A review. Physica B: Condensed Matter438, 1–8 (2014)

  38. [46]

    Y . Li, E. Baker, T. Reissman, C. Sun, W. K. Liu, Design of mechanical metamaterials for simultaneous vibration isolation and energy harvesting.Applied Physics Letters111(25) (2017). 28

  39. [47]

    G. Lee, D. Lee, J. Park, Y . Jang, M. Kim, J. Rho, Piezoelectric energy harvesting using mechanical metamaterials and phononic crystals.Communications Physics5(1), 94 (2022)

  40. [48]

    J. Li, L. Fok, X. Yin, G. Bartal, X. Zhang, Experimental demonstration of an acoustic magnifying hyperlens.Nature Materials8(12), 931–934 (2009)

  41. [49]

    Zhu,et al., A holey-structured metamaterial for acoustic deep-subwavelength imaging.Nature Physics7(1), 52–55 (2011)

    J. Zhu,et al., A holey-structured metamaterial for acoustic deep-subwavelength imaging.Nature Physics7(1), 52–55 (2011)

  42. [50]

    Kaina, F

    N. Kaina, F. Lemoult, M. Fink, G. Lerosey, Negative refractive index and acoustic superlens from multiple scattering in single negative metamaterials.Nature525(7567), 77–81 (2015)

  43. [51]

    Bolanowski Jr, J

    S. Bolanowski Jr, J. J. Zwislocki, Intensity and frequency characteristics of Pacinian corpuscles. I. Action potentials.Journal of Neurophysiology51(4), 793–811 (1984)

  44. [52]

    J. Bell, S. Bolanowski, M. H. Holmes, The structure and function of Pacinian corpuscles: A review. Progress in Neurobiology42(1), 79–128 (1994)

  45. [53]

    R. T. Verrillo, Effect of contactor area on the vibrotactile threshold.The Journal of the Acoustical Society of America35(12), 1962–1966 (1963)

  46. [54]

    R. T. Verrillo, Vibrotactile thresholds measured at the finger.Perception & Psychophysics9(4), 329–330 (1971)

  47. [55]

    Etaix, J

    N. Etaix, J. Dubois, M. Fink, R.-K. Ing, Increasing the modal density in plates for mono-element focusing in air.The Journal of the Acoustical Society of America134(2), 1049–1054 (2013)

  48. [56]

    Dupr´e, P

    M. Dupr´e, P. Del Hougne, M. Fink, F. Lemoult, G. Lerosey, Wave-field shaping in cavities: Waves trapped in a box with controllable boundaries.Physical Review Letters115(1), 017701 (2015)

  49. [57]

    E. G. Williams, P. Roux, M. Rupin, W. Kuperman, Theory of multiresonant metamaterials for A0 Lamb waves.Physical Review B91(10), 104307 (2015)

  50. [58]

    Daunizeau, D

    T. Daunizeau, D. Gueorguiev, S. Haliyo, V . Hayward, Phononic crystals applied to localised surface haptics.IEEE Transactions on Haptics14(3), 668–674 (2021)

  51. [59]

    van Kuilenburg, M

    J. van Kuilenburg, M. A. Masen, E. van der Heide, A review of fingerpad contact mechanics and friction and how this affects tactile perception.Proceedings of the Institution of Mechanical Engineers, Part J: Journal of Engineering Tribology229(3), 243–258 (2015)

  52. [60]

    Darabi, A

    A. Darabi, A. Zareei, M.-R. Alam, M. J. Leamy, Broadband bending of flexural waves: Acoustic shapes and patterns.Scientific Reports8(1), 11219 (2018)

  53. [61]

    J. P. Hespanha,Linear systems theory(Princeton University Press) (2018)

  54. [62]

    S. A. Cummer, J. Christensen, A. Al`u, Controlling sound with acoustic metamaterials.Nature Reviews Materials1(3), 1–13 (2016)

  55. [63]

    G. Ma, P. Sheng, Acoustic metamaterials: From local resonances to broad horizons.Science Advances 2(2), e1501595 (2016). 29

  56. [64]

    Lemoult, N

    F. Lemoult, N. Kaina, M. Fink, G. Lerosey, Soda cans metamaterial: A subwavelength-scaled phononic crystal.Crystals6(7), 82 (2016)

  57. [65]

    D. Beli, J. Arruda, M. Ruzzene, Wave propagation in elastic metamaterial beams and plates with interconnected resonators.International Journal of Solids and Structures139, 105–120 (2018)

  58. [66]

    Miranda Jr, E

    E. Miranda Jr, E. Nobrega, S. Rodrigues, C. Aranas Jr, J. Dos Santos, Wave attenuation in elastic metamaterial thick plates: Analytical, numerical and experimental investigations.International Journal of Solids and Structures204, 138–152 (2020)

  59. [67]

    A. Colombi,et al., Elastic wave control beyond band-gaps: Shaping the flow of waves in plates and half-spaces with subwavelength resonant rods.Frontiers in Mechanical Engineering3, 10 (2017)

  60. [68]

    Colquitt, A

    D. Colquitt, A. Colombi, R. Craster, P. Roux, S. Guenneau, Seismic metasurfaces: Sub-wavelength resonators and Rayleigh wave interaction.Journal of the Mechanics and Physics of Solids99, 379–393 (2017)

  61. [69]

    Jin,et al., Physics of surface vibrational resonances: Pillared phononic crystals, metamaterials, and metasurfaces.Reports on Progress in Physics84(8), 086502 (2021)

    Y . Jin,et al., Physics of surface vibrational resonances: Pillared phononic crystals, metamaterials, and metasurfaces.Reports on Progress in Physics84(8), 086502 (2021)

  62. [70]

    odd-one-out

    M. Rupin, P. Roux, G. Lerosey, F. Lemoult, Symmetry issues in the hybridization of multi-mode waves with resonators: An example with Lamb waves metamaterial.Scientific Reports5(1), 13714 (2015). 30 Acknowledgments Funding:No funding was received. Author Contributions:G.R. and ...

  63. [71]

    for square domains of edge length d= 9.5 , 6.5, and 3.5 cm; these spectra were used to compute the band-averaged summaries presented Fig. 6B. 43 Fig. S8. Extended behavioral experiment results for the pixel identification task.(A) Participants placed the five fingertips of the...

Pith tools

Reviewed June 27, 2026 · model on record in the stance chip above.