Pith. sign in

REVIEW 3 major objections 4 minor 2 cited by

Transforming the Hybrid Cloud for Emerging AI Workloads

T0 review · 3 major / 4 minor · reviewed 2026-08-12 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read This white paper argues that today's hybrid cloud stack cannot keep up with AI workloads and that a full-stack redesign centered on LLM-based abstractions, agentic AI, and cross-layer automation could yield 100-1000x performance-per-watt…

desk verdict A candid white paper with a coherent research agenda; the 100–1000x efficiency target is an under-specified aspiration that the AI control plane's own cost may erode. read the letter →

arxiv 2411.13239 v2 pith:FUCH2XCI submitted 2024-11-20 cs.DC cs.AIcs.ARcs.ETcs.MA

Deming Chen , Alaa Youssef , Ruchi Pendse , André Schleife , Bryan K. Clark , Hendrik Hamann , Jingrui He , Teodoro Laino
show 37 more authors
Lav Varshney Yuxiong Wang Avirup Sil Reyhaneh Jabbarvand Tianyin Xu Volodymyr Kindratenko Carlos Costa Sarita Adve Charith Mendis Minjia Zhang Santiago Núñez-Corrales Raghu Ganti Mudhakar Srivatsa Nam Sung Kim Josep Torrellas Jian Huang Seetharami Seelam Klara Nahrstedt Tarek Abdelzaher Tamar Eilam Huimin Zhao Matteo Manica Ravishankar Iyer Martin Hirzel Vikram Adve Darko Marinov Hubertus Franke Hanghang Tong Elizabeth Ainsworth Han Zhao Deepak Vasisht Minh Do Sahil Suneja Fabio Oliveira Giovanni Pacifici Ruchir Puri Priya Nagpurkar
This is my paper · ORCID
classification cs.DCcs.AIcs.ARcs.ETcs.MA
keywords hybridcloudAIworkloadsLLMasanAbstractionagenticfull-stackco-designperformanceperwattenergyefficiencyquantumcomputing
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This white paper argues that incremental improvements to today's hybrid cloud stack will not absorb the coming wave of AI workloads; the solution it advances is a coordinated, full-stack redesign. The central proposals are LLM as an Abstraction (LLMaaA), a natural-language interface in which a Master Agent coordinates specialized AI and non-AI agents, and THINKagents, a research framework for making such agentic systems reliable. Around these sit a unified control plane, cross-layer automation, reconfigurable infrastructure built on cache-coherent interconnects and SmartNICs, energy-aware orchestration, and eventual integration of quantum accelerators. The paper's stated aspiration is a 100-1000x improvement in performance per watt and 100x cost-performance gains once the pieces come together. A sympathetic reader should read this as a research agenda and a bet on where the field is heading, supported by a set of prototype results from the authors' collaborations.

What carries the argument

The load-bearing object is LLM as an Abstraction (LLMaaA), defined as a natural-language system interface built from a Master Agent, Interface Agents, and a heterogeneous pool of LLM and non-LLM agents that communicate through a standardized plug-and-play protocol and run as autoscaling pods on Kubernetes-style clusters. The companion machinery is THINKagents, an agentic-AI research framework that supplies short- and long-term memory, engineered tools, planning and task decomposition, reflection, and self-criticism, mirroring ideas from cognitive science. Around these sit the mechanisms that carry the efficiency claim: a unified control plane with a multi-cloud broker for workload decomposition, cross-layer automation and observability, cache-coherent interconnects (CXL, UAL) with near-data processing, programmable SmartNICs and reconfigurable switches and FPGAs, energy-aware DVFS and graph-reinforcement-learning schedulers, and a quantum-classical integration path. The argument works by showing how each layer converts the abstraction into concrete optimizations: agents turn user intent into executable workflows, the control plane maps those to heterogeneous resources, and reconfigurable hardware plus energy-aware scheduling deliver the projected order-of-magnitude gains.

What would settle it

Pit the agentic stack against a fixed set of real production incidents, such as Kubernetes controller misconfigurations, network faults, and SLO violations, and count how many are resolved correctly without human help; if the rate is at or below what human operators achieve on the same set, the 100-1000x aspiration loses its load-bearing premise.

Watch

Extended reading notes

Core claim

The central claim is that order-of-magnitude gains in efficiency, affordability, and usability of AI computing will come not from any single technology but from re-imagining the entire hybrid cloud stack around AI itself. The paper proposes that natural language, mediated by LLMaaA, becomes the primary interface for building, deploying, and managing applications: a Master Agent selects and coordinates plug-and-play LLM and non-LLM agents, tracks their quality, and continuously updates them, while the THINKagents framework supplies memory, planning, tools, and reflection so that multi-agent systems can handle long-horizon tasks without compounding errors. Under that abstraction layer, a unified control plane and multi-cloud broker decompose jobs and map them to specialized resource managers, and cross-layer automation ties scheduling, monitoring, and SLO enforcement together. At the hardware level, cache-coherent interconnects such as CXL and UAL, programmable SmartNICs, reconfigurable accelerators, and software-defined interfaces enable fine-grained cooperative computing among CPUs, GPUs, memory, storage, and network devices, with application-adaptive reconfiguration projected to deliver up to 100x performance gains. The paper presents representative prototypes, including a unified GPU memory architecture, an energy-efficient LLM inference framework, formally verified Kubernetes controllers, and renewable-energy modular data centers, as evidence that the pieces are feasible; the 100-1000x performance-per-watt aspiration is the projected outcome when all pieces are integrated.

Load-bearing premise

The plan depends on language-model-based agents being trustworthy enough to run real cloud systems, while the paper itself admits they can hallucinate and are hard to reconfigure and update.

Editorial extensions

If this is right

  • If LLMaaA works as described, a user with no cluster expertise can submit a job in natural language and have it scheduled, debugged, and run across HPC, cloud, and edge resources.
  • A unified control plane with a multi-cloud broker would let hybrid clouds burst automatically across providers and resource managers, treating cost, carbon, and SLOs as first-class scheduling inputs.
  • Cache-coherent interconnects and software-defined interfaces could make heterogeneous computing cooperative enough that large-model inference no longer requires buying multiple high-end GPUs.
  • Energy-aware orchestration at server, cluster, and datacenter scales could cut AI training and inference carbon footprints substantially while keeping latency targets.
  • Quantum accelerators would enter the same control plane, so scientific workflows could mix classical, AI, and quantum simulation steps in one job.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Editorial inference: the 100-1000x performance-per-watt figure is an aspiration, not a demonstrated result; the honest reading is that the paper offers evidence for individual pieces, not for the integrated number.
  • Editorial inference: if natural-language abstraction becomes the primary interface, the dominant cost and failure mode shifts from programming skill to prompt quality, agent evaluation, and trust; benchmark suites for agent reliability will become as important as compilers.
  • Editorial inference: a testable near-term extension is to run the LLMaaA agent pool against standardized IT-incident sets and compare resolution rates with human operators; the paper itself calls for such an IT-automation benchmark.
  • Editorial inference: the dependence on agentic AI means hallucination rates must fall by orders of magnitude, or the orchestration layer needs formal guardrails, before the vision can manage production systems.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 4 minor

Summary. This white paper, prepared by IBM Research and UIUC within the IIDAI institute, proposes a 5-10 year research agenda to transform hybrid cloud systems for emerging AI workloads. It motivates the need for change through the complexity, cost, energy, and fragmentation of current systems (Section 3), and sets out a vision (Section 4.1) of full-stack co-design with LLM-as-an-Abstraction (LLMaaA), agentic AI (THINKagents), cross-layer automation, unified control planes, reconfigurable hardware, edge-cloud integration, and quantum-classical workflows. The paper describes research directions in model optimization, programming models, middleware, infrastructure, energy and sustainability, and security (Sections 4.4-4.9), and discusses applications in materials discovery and climate (Section 5). It also reports several concrete component-level results from the collaboration, such as LIA (12.4x lower inference latency, 6.0x higher throughput), FIRM (16x fewer SLO violations), UniNet (7.08x CNI throughput), and SkyBox (46% carbon-footprint reduction). The paper's central quantitative aspiration is '100-1000x improvement in performance/watt when all the pieces come together' (Section 4.1, also Section 1), explicitly labeled as an aspiration rather than a demonstrated result.

Significance. The paper is a broad and internally coherent research agenda that assembles a large set of concrete projects and preliminary results. It is honest about key bottlenecks: Section 4.3.1 concedes that LLMs hallucinate, lack reconfigurability, and do not evolve online; Section 4.2.2 concedes that current agents handle only simple tasks; Section 4.8.1 notes that automated operations introduce single points of failure. If the vision were realized, the societal and technical impact would be substantial, especially for affordability and energy sustainability of AI. However, the significance as a journal contribution is currently limited by the absence of an end-to-end quantitative evaluation or a derivation of the headline efficiency target; the paper functions better as a research roadmap than as a validated technical result.

major comments (3)
  1. [Section 4.1 and Section 1] The 100-1000x performance/watt target is stated as an aspiration ('when all the pieces come together') with no baseline, no system boundary, and no accounting for the energy and latency of the LLM/agent control plane that LLMaaA and THINKagents place in the critical path. Because Section 3.3 reports that a ChatGPT query consumes about 10x the electricity of a Google search, the reader cannot tell whether the AI control plane would consume most of the claimed gain. The authors should either provide a first-order system-level model that includes controller overhead, or explicitly restrict the target to a defined subsystem and say so in the abstract.
  2. [Section 4.9.3, Section 4.1, and Section 2.3] The claim of up to 100x performance gains from reconfigurable and programmable cloud infrastructure is unsupported; Section 4.9.3 states 'achieving up to 100x higher performance gains' without derivation, citation, or experimental evidence, and Section 4.1 makes a similar 'up to 100x' claim for coordinated reconfiguration. The same applies to the '100x cost/performance improvements' stated in Section 2.3. These numbers are load-bearing for the overall efficiency story and need either supporting evidence or a clear label as motivational targets.
  3. [Sections 4.2.2 and 4.3.1] The feasibility of LLMaaA as the primary interface for building, deploying, and managing cloud systems depends on agent dependability, security, and scalability, yet the paper itself acknowledges that LLMs are prone to hallucination, lack reconfigurability, and fail to evolve online (Section 4.3.1), and that current agents succeed only on tasks that take humans a few minutes (Section 4.2.2). The paper should propose a concrete evaluation or verification strategy (e.g., the IT-automation benchmark proposed in Section 4.2.4) that would establish when agentic control is dependable enough for production use, or should temper the governance role claimed for the Master Agent in Section 4.3.2.
minor comments (4)
  1. [Section 4.3.2] The example is dated 'in October 2029,' which is likely a typo; unless a far-future scenario is intentional, the date should be corrected to the paper's publication timeframe.
  2. [Section 4.8.2] The text 'when AI workloads such as LMM bring exponential growth' should read 'LLM' rather than 'LMM.'
  3. [Section 3.2] Expressions such as '10-24' and '1018' are missing superscript formatting and read as arithmetic; they should be typeset as 10^-24 and 10^18.
  4. [Section 4.6.3] The LIA framework is described with quantitative results (12.4x lower latency, 6.0x higher throughput) but no citation is given in the provided text; please add a reference to the corresponding publication.

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity: the paper is a forward-looking research agenda with no fitted parameters, no equations, and no prediction derived from its own prior results.

full rationale

This white paper is a vision and research agenda rather than a derivation. It does not claim to predict a quantitative outcome from first principles; the 100-1000x performance/watt statement in Section 4.1 is explicitly an aspiration ('Our aspiration is to achieve...'), not a computed result. The paper cites many prior works by the same authors (e.g., DeepSpeed-Ulysses, ZeRO-Offload, G10, EcoFaaS, FIRM, Acto, Anvil, Rainmaker, BoFL, SkyBox), but these citations are presented as representative contributions or evidence that specific directions are feasible, not as load-bearing uniqueness theorems or as definitions of the central vision. The central concepts (LLMaaA, THINKagents, unified control plane, cross-layer automation) are proposed as new research directions; they are not defined in terms of the outcomes they are claimed to enable. No equation is introduced, so no equation reduces to its own input. The paper's own acknowledgments of LLM limitations (hallucination, lack of reconfigurability and evolvability in Section 4.3.1) are honest statements of open challenges, not hidden admissions of circularity. A skeptical concern that the LLM/agent control plane's energy cost is omitted from the 100-1000x aspiration is a completeness or correctness critique of a vision statement, not a circularity critique: the target is not derived from a model that excludes that cost. Under the stated rules, absence of fitted inputs, absence of derived predictions, and absence of self-citation chains that force the conclusion mean the correct finding is no significant circularity.

Assumptions & free parameters 0 free parameters · 3 assumptions · 2 invented entities

The paper is a vision document; its central claims rest on assumptions about future technology trajectories and about the reliability of LLM-based systems, rather than on parameters fit to data.

assumptions (3)
  • domain assumption AI compute demand will continue to grow exponentially, making incremental improvements insufficient.
    The paper motivates transformation based on projected exponential growth of model sizes and data (Section 1, Figure 5), but this trajectory is assumed, not proven.
  • domain assumption LLMs and agentic AI can be made reliable, secure, and scalable enough to serve as system abstractions and management layers.
    LLMaaA and THINKagents depend on LLMs performing reliably in production; the paper itself notes hallucination and reliability challenges (Section 4.3.1).
  • domain assumption Emerging hardware technologies (CXL, UAL, AMX, GPUDirect, quantum) will mature and integrate into hybrid clouds within the 5-10 year horizon.
    The vision relies on these technologies being available and economically viable, which is stated as expectation, not demonstrated.
invented entities (2)
  • LLM-as-an-Abstraction (LLMaaA)
    purpose: A proposed natural-language interface and orchestration abstraction for building, deploying, and managing cloud applications through a Master Agent and agent pool.
    Introduced as a concept in Section 4.3; no implementation or testable prediction provided.
  • THINKagents
    purpose: A proposed research framework for agentic AI systems with memory, tools, and planning components.
    Described in Section 4.2; builds on existing agentic AI work but offers no falsifiable handle or benchmark results attributable to the framework itself.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Transforming the Hybrid Cloud for Emerging AI Workloads." pith.science (2026). https://pith.science/paper/FUCH2XCI

@misc{pith2026241113239,
  author       = {Pith},
  title        = {Pith review of: Transforming the Hybrid Cloud for Emerging AI Workloads},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/FUCH2XCI}},
  note         = {Machine review of arXiv:2411.13239}
}
read the original abstract

This white paper, developed through close collaboration between IBM Research and UIUC researchers within the IIDAI Institute, envisions transforming hybrid cloud systems to meet the growing complexity of AI workloads through innovative, full-stack co-design approaches, emphasizing usability, manageability, affordability, adaptability, efficiency, and scalability. By integrating cutting-edge technologies such as generative and agentic AI, cross-layer automation and optimization, unified control plane, and composable and adaptive system architecture, the proposed framework addresses critical challenges in energy efficiency, performance, and cost-effectiveness. Incorporating quantum computing as it matures will enable quantum-accelerated simulations for materials science, climate modeling, and other high-impact domains. Collaborative efforts between academia and industry are central to this vision, driving advancements in foundation models for material design and climate solutions, scalable multimodal data processing, and enhanced physics-based AI emulators for applications like weather forecasting and carbon sequestration. Research priorities include advancing AI agentic systems, LLM as an Abstraction (LLMaaA), AI model optimization and unified abstractions across heterogeneous infrastructure, end-to-end edge-cloud transformation, efficient programming model, middleware and platform, secure infrastructure, application-adaptive cloud systems, and new quantum-classical collaborative workflows. These ideas and solutions encompass both theoretical and practical research questions, requiring coordinated input and support from the research community. This joint initiative aims to establish hybrid clouds as secure, efficient, and sustainable platforms, fostering breakthroughs in AI-driven applications and scientific discovery across academia, industry, and society.

Figures

Figures reproduced from arXiv: 2411.13239 by the authors.

Figure 27
Figure 27. IBM Quantum systems with error mitigation and error correction capabilities. [PITH_FULL_IMAGE:figures/full_fig_p057_27.png] view at source ↗

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Toward Edge General Intelligence with Agentic AI and Agentification: Concepts, Technologies, and Future Directions

    cs.NI 2025-08 conditional novelty 4.0 of 10

    A survey that organizes agentic AI for 6G edge networks into four pillars, compactness, efficiency, knowledge and reasoning, and migration, and illustrates them with prior case studies.

  2. Leveraging Large Language Model for Intelligent Log Processing and Autonomous Debugging in Cloud AI Platforms

    cs.AI 2025-06 reject novelty 4.0 of 10

    A cloud log debugging framework combining log clustering, LLM reasoning, and reinforcement-learning recovery planning is claimed to improve fault location accuracy by 16.2 percent, but the supporting accuracy experime...

Reference graph

Works this paper leans on

9 extracted references · 2 canonical work pages · cited by 2 Pith papers

  1. [11]

    and Ji, H., 2024

    Wang, X., Chen, Y., Yuan, L., Zhang, Y., Li, Y., Peng, H. and Ji, H., 2024. Executable code actions elicit better llm agents. arXiv preprint arXiv:2402.01030. [12] Wang, X., Peng, H., Jabbarvand, R. and Ji, H., 2023. Leti: Learning to generate from textual interactions. arXiv preprint arXiv:2305.10314. [13] Pan, R., Ibrahimzada, A.R., Krishna, R., Sankar,...

    arXiv 2024

  2. [28]

    Automated Code generation for Information Technology Tasks in YAML through Large Language Models

    Chen, M., Tworek, J., Jun, H., Yuan, Q., Pinto, H.P.D.O., Kaplan, J., Edwards, H., Burda, Y., Joseph, N., Brockman, G. and Ray, A., 2021. Evaluating large language models trained on code. arXiv preprint arXiv:2107.03374. [29] https://github.com/IBM/Project_CodeNet. [30] Jain, N., Shetty, M., Zhang, T., Han, K., Sen, K. and Stoica, I., 2024. R2E: Turning a...

    arXiv 2024

  3. [45]

    SPLAT: A framework for optimised GPU code-generation for SParse reguLar ATtention

    Albert Gu, Tri Dao. 2023. Mamba: Linear-Time Sequence Modeling with Selective State Spaces, ArXiv, abs/2312.00752. [46] Gupta, Ahan, et al. "SPLAT: A framework for optimised GPU code-generation for SParse reguLar ATtention." arXiv preprint arXiv:2407.16847 (2024). [47] Sam Ade Jacobs, Masahiro Tanaka, Chengming Zhang, Minjia Zhang, Reza Yazdani Aminabadi,...

    arXiv 2024

  4. [91]

    Sapphire rapids: The next-generation intel xeon scalable processor

    Nassif, Nevine, Ashley O. Munch, Carleton L. Molnar, Gerald Pasdast, Sitaraman V. Lyer, Zibing Yang, Oscar Mendoza et al. "Sapphire rapids: The next-generation intel xeon scalable processor." In 2022 IEEE International Solid-State Circuits Conference (ISSCC), vol. 65, pp. 44-46. IEEE, 2022. [92] Shu-Ting Wang, Hanyang Xu, Amin Mamandipoor, Rohan Mahapatra...

    arXiv 2022

  5. [105]

    A 12nm Linux-SMP-Capable RISC-V SoC with 14 Accelerator Types, Distributed Hardware Power Management and Flexible NoC-Based Data Orchestration,

    J. Alsop, M. D. Sinclair, and S. V. Adve. Spandex: A Flexible Interface for Efficient Heterogeneous Coherence. Proceedings of the 45th International Symposium on Computer Architecture (ISCA), June 2018. [106] Maico Cassel Dos Santos, Tianyu Jia, Joseph Zuckerman, Martin Cochet, Davide Giri, Erik Jens Loscalzo, Karthik Swaminathan, Thierry Tambe, Jeff Jun ...

    work page 2018

  6. [125]

    Exploring the Efficiency of Renewable Energy-based Modular Data Centers at Scale

    Wei Ren, William Kozlowski, Sandhya Koteshwara, Mengmei Ye, Hubertus Franke, and Deming Chen. AccShield: a New Trusted Execution Environment with Machine-Learning Accelerators. ACM/IEEE Design Automation Conference, July 2023. [126] Wei Ren, Sandhya Koteshwara, Mengmei Ye, Hubertus Franke, and Deming Chen. S2TAR-Cloud: Shared Secure Trusted Accelerators w...

    work page Pith review arXiv 2023

  7. [138]

    Nimblock: Scheduling for Fine-grained FPGA Sharing through Virtualization,

    Zeke Wang, Hongjing Huang, Jie Zhang, Fei Wu, and Gustavo Alonso. FpgaNIC: An FPGA-based Versatile 100Gb SmartNIC for GPUs. In Proceedings of the 2022 USENIX Annual Technical Conference (USENIX ATC 22), pages 967-986, Carlsbad, CA, 2022. USENIX Association. https://www.usenix.org/conference/atc22/presentation/wang-zeke. [139] Baolin Li, Tirthak Patel, Sid...

    arXiv 2023

  8. [154]

    An Image is Worth 16x16 Words: Transformers for Image Recognition at Scale

    Krenn, M., Ai, Q., et al. SELFIES and the future of molecular string representations. Patterns, 2022, 3, 10, 100588. [155] Born, J., Manica, M. Regression Transformer enables concurrent sequence regression and generation for molecular language modelling. Nat Mach Intell 5, 432–444 (2023). [156] Park, N.H., Manica, M., Born, J. et al. Artificial intelligen...

    arXiv 2023

Show all 9 references
  1. [169]

    On the Duality of Teleportation and Dense Coding,

    E. Chitambar and F. Leditzky, “On the Duality of Teleportation and Dense Coding,” in IEEE Transactions on Information Theory, vol. 70, no. 5, pp. 3529-3537, May 2024, https://doi.org/10.1109/TIT.2023.3331821. [170] Arunachalam, Srinivasan, Vojtech Havlicek, and Louis Schatzki....

    2024

Pith tools

Reviewed August 12, 2026 · model on record in the stance chip above.